KEGG   Clostridium pasteurianum DSM 525 = ATCC 6013: CLPA_c27910Help
Entry
CLPA_c27910       CDS       T03753                                 

Gene name
alr1
Definition
(GenBank) alanine racemase 1
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cpat  Clostridium pasteurianum DSM 525 = ATCC 6013
Pathway
cpat00473  D-Alanine metabolism
cpat01100  Metabolic pathways
cpat01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cpat00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLPA_c27910 (alr1)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CLPA_c27910 (alr1)
Enzymes [BR:cpat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CLPA_c27910 (alr1)
Peptidoglycan biosynthesis and degradation proteins [BR:cpat01011]
 Precursor biosynthesis
  Racemase
   CLPA_c27910 (alr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AJA52846
UniProt: A0A0H3J9N6
LinkDB All DBs
Position
complement(2985480..2986640)
Genome map
AA seq 386 aa AA seqDB search
MFKHLRPVWAEINVDNLEFNMRGIKKLSKSNEIFGVVKADAYGHGAVDVAAVLLENGVTR
LSVAVVSEAVELRRAGIECPIMILGYTPLSLADEILKYDIEQTVFSYEYALKLSSIAEKR
HIKVKIHIALDTGMGRIGFLPDGKSIEDVYKISRLPNIEIEGLFSHFSTADEENKEYTYR
QFEIFNSFYKKLKEKGVSVRIRHIANSAAIMELPNTHLDGVRPGIILYGYYPSGEVDKSR
LELKPVMTLKTNIVHIKTLKKGEYISYGRKFTCEKDSIIATLPVGYADGYTRLMFGKAKV
IINDKFAPVVGRICMDQCMVDISHIPEAKVGDEVILMGQSLNCKFDADDIAKNIDTINYE
VVCMVSKRVPRVYVKHGKVTKIRNYV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacatttaagacctgtttgggcagaaattaatgttgataatttagaatttaat
atgagagggataaaaaagctttccaaaagtaatgaaatctttggagtggtaaaagctgat
gcctatggacatggagctgttgatgttgcagctgtgcttttagaaaacggtgttactaga
ttgtcagtggcagtagtaagtgaggctgtagaacttagaagagcgggaattgaatgtcct
attatgattttaggatatactcctttaagtcttgctgatgaaatactaaaatatgatata
gaacaaactgtattttcctatgaatatgcattgaaactttcttcaatagccgaaaagaga
catataaaagttaaaatacacatagcattagatacggggatggggagaattggatttttg
cctgatggtaaaagtatagaggatgtatataaaataagcaggttgccaaatatagagata
gaaggattgttttctcatttttctacagcggatgaagaaaataaggaatatacttacagg
caatttgaaatttttaattctttttataaaaaacttaaagaaaagggtgtatcagtaaga
ataagacatatagctaatagtgctgctattatggaattgcctaatacacatcttgatgga
gtacgaccaggtataatattgtatggatattatccttccggggaagtagataagagcaga
ttagaattaaagcctgtaatgactttaaaaacaaatatagtacatataaaaactcttaaa
aaaggagaatacataagttatggtagaaaatttacctgtgaaaaagacagtattatagca
acattacctgtaggttatgctgatggttatacaagacttatgtttggaaaagcaaaagtt
ataataaatgataaatttgccccagtggttggaagaatttgcatggatcagtgtatggta
gatatatctcatattcctgaagctaaagttggagatgaagttatacttatgggacagtct
ttaaattgtaaatttgatgccgatgatattgctaaaaatatagacactataaattatgaa
gttgtttgtatggtaagtaaaagagttcctagggtttatgtgaaacatggaaaagttaca
aaaataaggaactatgtataa

DBGET integrated database retrieval system