KEGG   Cupriavidus pauculus: EHF44_04325Help
Entry
EHF44_04325       CDS       T05738                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cpau  Cupriavidus pauculus
Pathway
cpau00550  Peptidoglycan biosynthesis
cpau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpau00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHF44_04325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cpau01002]
    EHF44_04325
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cpau01011]
    EHF44_04325
Enzymes [BR:cpau01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EHF44_04325
Peptidases and inhibitors [BR:cpau01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   EHF44_04325
Peptidoglycan biosynthesis and degradation proteins [BR:cpau01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   EHF44_04325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AZG12720
UniProt: A0A3G8GXM0
LinkDB All DBs
Position
1:570841..572046
Genome map
AA seq 401 aa AA seqDB search
MLNRATPHFASALAPVAVAATLAAALAAAPAAVLAQGVPMPQVAAKSWMLYDVTSGQALA
AQNADLRIEPASLTKLMTAYLAFEALKEKRLTLDQTVTPTEIVRKVKSDESRMFIEAGKP
VTVNDLLLGLIVQSGNDAALALAEAVGGSEDGFVAMMNREAQRMGMKGTHFTNTDGVPDP
NHYTTAVDLATLTTRLIKDFPEYYAMYSQKEFTYNKIRQPNRNRLLYIDPTVDGVKTGHT
KSAGYCLISSAQRPLANVPNGQRRLVSIVIGTASEQIRTQESLKILNYGFQFFDTLRLYD
KGQVLATPDIYKGRASTVKIGVANETFVTVPKGTGGRLKPVLERQELLIAPIAAGQQVGT
VKLMDGNNKVGEFPVVALEEVPEAGFFGRLWDTIRLWFKRK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacagagccacgccgcacttcgcatccgcccttgctcccgtcgccgttgccgcg
acgctcgccgccgcgcttgccgccgcccccgccgccgtgctggcgcagggcgtgccgatg
ccgcaggtggccgccaagtcctggatgctgtacgacgtgaccagcggccaggccctggcc
gcccagaacgccgacctgcgcatcgagcccgcgtcgctgaccaagctgatgaccgcctac
ctggcgttcgaggcgctcaaggaaaagcgcctgacgctggaccagaccgtgacacccacc
gagatcgtgcgcaaggtcaaaagcgatgagtcgcgcatgttcatcgaggccggcaagccg
gtcaccgtcaacgacctgctgctgggcctgatcgtgcagtcgggcaacgacgccgcgctg
gcgctggccgaggccgtgggcgggtccgaggacggctttgtcgcgatgatgaaccgcgag
gcccagcgcatgggcatgaagggcacgcacttcaccaacaccgacggcgtgcccgacccg
aaccactacaccacggcggtggacctggccacgctgaccacgcgcctgatcaaggacttc
cccgagtactacgcgatgtactcgcagaaggagttcacctataacaagatcaggcagccc
aaccgcaaccgcctgctgtacatcgacccgaccgtggacggcgtgaagaccggccacacc
aagtccgccggctactgcctgatctcgtcggcccagcgcccgctggccaacgtgccgaac
ggccagcgccgcctggtgtcgatcgtgatcggcacggcgtccgagcagatccgcacgcag
gaaagcctgaagatcctgaactacggcttccagttcttcgacacgctgcgcctgtacgac
aagggccaggtgctggccacgcccgacatctacaagggccgcgccagcacggtcaagatc
ggcgtggccaacgagacgttcgtcacggtgcccaagggcacgggcgggcgcctgaagccg
gtgctggagcgccaggagctgctgatcgccccgatcgcggccggccagcaggtgggcacg
gtcaagctgatggacggcaacaacaaggtgggcgaattccccgtggtggcgctggaagaa
gtgcccgaggccggcttcttcggccggctgtgggatacgatccgcctctggttcaagcgc
aagtaa

DBGET integrated database retrieval system