KEGG   Cupriavidus pauculus: EHF44_09115Help
Entry
EHF44_09115       CDS       T05738                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cpau  Cupriavidus pauculus
Pathway
cpau00620  Pyruvate metabolism
cpau00680  Methane metabolism
cpau00710  Carbon fixation in photosynthetic organisms
cpau01100  Metabolic pathways
cpau01120  Microbial metabolism in diverse environments
cpau01200  Carbon metabolism
Module
cpau_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cpau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EHF44_09115
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    EHF44_09115
   00680 Methane metabolism
    EHF44_09115
Enzymes [BR:cpau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EHF44_09115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 AAA_22
Motif
Other DBs
NCBI-ProteinID: AZG13597
UniProt: A0A3G8GZK2
LinkDB All DBs
Position
1:complement(1611875..1614901)
Genome map
AA seq 1008 aa AA seqDB search
MTQPAARPTGRTRSTSRKPTSPASPASGQHDAPGAAPDATPRKTPSRNAAPRAKPTLSVV
TAEGNTVAPARRTADKDVPLREDIRFLGRLLGDCVREQEGDAAFDLVETIRQTAVRFRRE
NDRAAGAELDRLLKRLSRDQTNSVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQPG
SLARALEAIDAAGVTGKQVRDFLNDALIMPVLTAHPTEVQRKSILDAEREIARLLAERDL
PMTARERDHNTAQLRARVTTLWQTRMLRNTRLMVVDEIENALSYYRTTFLQGIPRLMADL
EEDLAQVFPRRSKAGAVPEPLAPFLQMGSWIGGDRDGNPNVTAETLQHAAQQQSSLIMQW
YLDEVHALGAELPLSSLMVDASAELLALADASPDHSDHRADEPYRRALIGIYARLAATTE
RLTGHVAPRHPVADVAPYDNAEAFAADIRIVLDSLRQHHGEALARGRIDALVRAIAIFGF
HLASVDMRQVSDVHEAVIAELFKAAGIAPDYAALPEPRKLELLLAELRQPRLLMLPWHDY
SEQTRKELAIFAMARDLRARYGNRVARNYIISHTETLSDLVEVMLLQKETGLLRGTLGSK
TDPARMELMVIPLFETIEDLRNAAGIMESLLDLPGFDAVIRHHGVEQEVMLGYSDSNKDG
GFLTSNWELYKAELALVKLFEARRVKLRLFHGRGGTVGRGGGPTYEAILSQPPGTVNGQI
RLTEQGEIINSKFANAEIGRRNLETVIAATLEASLLPTQNAPAGLATFEGIMQQLSDRAF
RAYRHLVYETPGFKDYFFATTPITEIADLNLGSRPASRKLMDKKHRKIEDLRAIPWGFSW
GQCRLLLPGWYGFGSAVKALLDEAPDEKSRKACVATLKRMVKTWPFFRTLMSNMDMVLAK
TDLAVASRYAALCDDAALRKTVFSRISAEWHLTCDMLSLITGRTERLAENPLLARSIKNR
FAYLDPLNHLQVELLKRYRAGKDADDVRVRRGIHLTINGVAAGLRNSG
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcctgctgcgcgccccaccggccgtacccgttccaccagccgcaagcccacc
tcgcccgcatcgcccgcctcgggccagcatgacgcgccgggcgccgccccggacgccacc
ccccgcaaaaccccgtcccgcaacgccgccccgcgcgccaagcccacgctgtccgtggtg
accgccgaaggcaacaccgtcgccccggcccgccgcaccgccgacaaggacgtgccgctg
cgcgaggacatccgctttctgggccgcctgctgggcgactgcgtgcgcgagcaggaaggc
gatgccgcgttcgacctcgtggaaaccatccgccagacggccgtgcgcttccgccgcgag
aacgaccgcgccgcgggcgccgagctggaccgcctgctcaagcggctgtcgcgcgaccag
accaattccgtggtgcgggcgttcagctacttctcgcacctggccaacatcgccgaggac
cagcaccacaaccgacgccgccgcgtgcacgcgctggccggatcgccgccgcagccgggc
agcctggcccgcgcgctggaagccatcgacgcggccggcgtgaccggcaagcaggtgcgg
gacttcctcaacgacgcgctgatcatgccggtgctaaccgcgcaccccaccgaggtgcag
cgcaagtcgatcctggacgccgagcgcgagattgcccgcctgctggccgagcgagacctg
ccgatgacggcccgcgagcgcgaccacaacaccgcacagctgcgcgcccgcgtgaccacg
ctctggcagacccgcatgctgcgcaacacgcgcctgatggtggtcgacgagatcgagaac
gcgctgtcctactaccgcacgacgttcctgcagggcattccccggctgatggccgacctg
gaggaggacctggcccaggtgttcccgcgccgcagcaaggccggcgccgtgcccgagccg
ctggcgccgttcctgcagatgggctcctggatcggcggcgaccgcgacggcaatccgaat
gtgacggccgagacgctccagcacgcggcccagcagcagtcgtcgctgatcatgcagtgg
tatctggacgaagtgcacgcgctgggggcggaactgccgctgtcgtcgctgatggtcgat
gccagcgccgagctgctggcgctggccgatgcctcgcccgaccactccgaccatcgcgcc
gacgagccgtaccgccgcgcgctgatcggcatctatgcgcggctggccgccaccaccgag
cgcctgaccggccacgtggccccgcgccatccggtggccgacgtggcgccgtacgacaac
gccgaggcgttcgcggccgacatccgcatcgtgctcgattcgctgcgccagcatcacggc
gaggcgctggcccggggccggatcgacgcgctggtgcgcgcgattgcgatcttcggcttc
cacctggcgtcggtggacatgcgccaggtgtcggacgtgcacgaggccgtcatcgccgaa
ctgttcaaggcggccggcatcgcgcccgactacgcggcgctgcccgagccccgcaagctg
gaactgctgctggccgaactgcgccagccgcgcctgctgatgctgccgtggcacgactat
tccgagcagacgcgcaaggagctggccatcttcgccatggcgcgcgacctgcgcgcccgc
tacggcaaccgcgtggcgcgcaactacatcatttcgcataccgagacgctgtccgacctc
gtggaagtgatgctgctgcagaaggaaaccgggctgctgcgcggcacgctgggcagcaag
accgatccggcccgcatggagctgatggtcatcccgctgttcgaaacgatcgaggatctg
cgcaacgcggccggcatcatggagtcgctgctggacctgcccggcttcgacgcggtgatc
cgccaccacggcgtggagcaggaagtgatgctcggctactcggactcgaacaaggacggc
ggcttcctgacgtcgaactgggagctgtacaaggccgaactggcgctggtgaagctgttc
gaggcgcgccgcgtgaagctgcggctgttccacggccgcggcggcaccgtggggcgcggc
ggcggcccgacctacgaggccatcctgtcgcagccgccgggcactgtgaacggccagatc
cggctgaccgagcagggcgagatcatcaatagcaagttcgccaatgcggagatcggccgg
cgcaacctggaaacggtgatcgcggccacgctggaggcgtcgctgctgcccacgcagaac
gcgccggccgggctggccacgttcgagggcatcatgcagcagttgtcggaccgggccttc
cgcgcctaccgccacctggtctacgagacgcccggcttcaaggactacttcttcgccacc
acgccgatcaccgagattgccgacctgaacctgggctcgcgcccggcctcgcgcaagctg
atggacaagaagcaccgcaagatcgaggacctgcgcgccattccgtggggcttctcgtgg
ggccagtgccggctgctgctgccgggctggtacggcttcggcagcgcggtcaaggcgctg
ctggacgaggcgccggacgagaaatcgcgcaaggcatgcgtggccacgttgaagcgcatg
gtcaagacgtggccgttcttccgcacgctgatgtcgaacatggacatggtgctggccaag
accgacctggccgtggcgtcgcgctacgcggcgctgtgtgacgacgccgcgctgcgcaag
accgtgttctcgcgcatcagcgccgaatggcacctgacctgcgacatgctgagcctgatc
acgggccgcaccgagcgcctggccgagaacccgctgctggcgcggtcgatcaagaaccgc
tttgcctacctggacccgctgaaccacctgcaggtggaactgctcaagcgctaccgcgcc
ggcaaggacgccgacgacgtccgcgtgcgacgcgggattcacttgacgatcaacggcgtg
gcggcggggttgcgcaacagcgggtga

DBGET integrated database retrieval system