KEGG   Cupriavidus pauculus: EHF44_11555Help
Entry
EHF44_11555       CDS       T05738                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cpau  Cupriavidus pauculus
Pathway
cpau00564  Glycerophospholipid metabolism
cpau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EHF44_11555
Enzymes [BR:cpau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EHF44_11555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA NAD_binding_8 FAD_binding_3 Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-ProteinID: AZG14024
UniProt: A0A3G8H0X5
LinkDB All DBs
Position
1:complement(2124926..2126530)
Genome map
AA seq 534 aa AA seqDB search
MSTYVPPVQPPSRAQLLDTLARTPRWDVIVIGGGATGLGTALDAAARGYRTLLLEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLARNAPHVVWPLGFVVPAYQMFDQP
FYGIGLKVYDMLAGGQNLSGSRWLNHRETLEAVPTLAEHVGGRPLRGGNLYFDGQFDDAR
LAMALMRTLFDVGGTAVNYLRVTGLAQRNGVVTGVTAQDALGDATFELRADCVINATGVW
VDAVRQMEDGQARTMVAPSQGVHLTIPRSFLPGDRAILIPKTDDGRVLFLVPWNGHVIVG
TTDTPRKDLPLEPRATGDDIDFILETAARYLARDPSRADVTSVWAGLRPLVKATGESSTA
SLSREHTILVSRAGLITVTGGKWTTYRKMAEDVIETAIQRQMLPAAPCRTASLPLHGATG
MPDDLPPANSGSPDRYYGADLPLVRALPGTDATIVPASGLTEAHVRFAARHELARRVEDV
LGRRNRALFLDARAALAGAPRVAEILAEELGHDAAWQARELEDFGALARGYLLE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctacgtacctccggtccagcctccctcgcgggcccagttgctcgatacgctg
gcgcgcacgccgcgctgggacgtgatcgtcatcggcggcggcgccaccggcctgggcacg
gcgctcgacgccgcggcgcgcggctatcgcaccctgctgctcgaagcggccgactttgcc
aagggcacgtccagcaaggccaccaagctcgtgcacggcggcgtgcgctacctggcccag
ggcaacatcagcctcgtgcgcgaggcgctgcacgaacgcggcctgctggcccgcaacgcg
ccgcacgtggtgtggccgctgggcttcgtggtgccggcctaccagatgttcgaccagccg
ttctacggcatcgggctcaaggtctacgacatgctggccggcgggcagaacctgtccggc
agccgctggctcaaccaccgcgagacgctggaagcggtgcccacgctggccgagcacgtc
ggcggccggccgctgcgcggcggcaacctctatttcgacggccagttcgacgacgcgcgg
ctggccatggcgctgatgcgcacgctgttcgacgtgggcggcacggccgtcaactacctg
cgcgtgaccggcctggcccagcgcaacggcgtggtcaccggcgtcacggcccaggacgcg
ctgggcgatgccacgttcgaactgcgcgccgactgcgtgatcaacgccaccggcgtgtgg
gtcgacgcggtgcggcagatggaggacggccaggcgcgcacgatggtggcgcccagccag
ggcgtgcacctgaccatcccgcgcagcttcctgcccggcgaccgcgcgatcctgatcccg
aagaccgacgacggccgcgtgctgttcctggtgccctggaacggccacgtcatcgtcggc
accaccgatacgccgcgcaaggacctgccgctggagccgcgcgccacgggcgacgacatc
gacttcatcctggaaacggccgcgcggtacctggcgcgcgacccgtcccgcgccgacgtg
accagtgtctgggccgggctgcggccgctggtcaaggccacgggcgagtcgtccaccgcg
tcgctgtcgcgcgagcacacgatcctcgtgtcgcgcgcgggcctgatcaccgtcaccggc
ggcaagtggaccacctatcgcaagatggccgaggacgtgatcgagaccgcgatccagcgc
cagatgctgcccgccgcgccgtgccgcacggccagcctgccgctgcacggcgccaccggc
atgcccgacgacctgccgccggccaactcgggctcgcccgaccgctactacggcgccgac
ctgccgctggtgcgcgcgctgcccggcaccgacgcgacgatcgtgccggcctccggcctg
accgaggcccacgtccgctttgcggcccgccacgaactggcgcgccgggtggaggacgtg
ctcggccggcgcaaccgcgcgctgtttttggacgcccgggccgcgctggccggcgcgccg
cgcgtggcggagatcctggccgaggaactgggccacgacgccgcctggcaggcgcgcgag
ctggaggactttggcgcgctggcgcgcggctacctgctggaatga

DBGET integrated database retrieval system