KEGG   Cupriavidus pauculus: EHF44_11605
Entry
EHF44_11605       CDS       T05738                                 

Definition
(GenBank) carbohydrate ABC transporter substrate-binding protein
  KO
K17321  glycerol transport system substrate-binding protein
Organism
cpau  Cupriavidus pauculus
Pathway
cpau02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cpau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EHF44_11605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpau02000]
    EHF44_11605
Transporters [BR:cpau02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Glycerol transporter
    EHF44_11605
SSDB
Motif
Pfam: SBP_bac_8 SBP_bac_1 DUF4863
Other DBs
NCBI-ProteinID: AZG15347
UniProt: A0A3G8H4B1
LinkDB
Position
1:2135207..2136937
AA seq 576 aa
MKLGMSALAFAAALTCGHAAWADEAAAKKWIDNEFQPSSLSKDKQQAELKWFIDAAAKLK
AKGVTQINVVSETITTHEYESKTLAKAFEEITGIKVNHDLIQEGDVVEKLQTSMQSGKSI
YDGWISDSDLIGTHYRYGAILPLTDYMNGAGKEFTNPGIDVKDFIGTKFTTAPDGKLYQL
PDQQFANLYWFRADWFARKDLQDKFKAKYGYDLGVPTNWSAYEDIANFFTNDVKELDGKK
VYGHMDYGKKDPSLGWRFTDAWLSMAGSADKGLPNGMPVDEWGIRVADDKCTPVGASVSR
GGATNSPAAVYALTKYIDWMKKYAPPQAMGMTFSEAGPVPAQGQVAQQIFWYTAFTADMT
KKGLPVVNADGSPKWRMAPSPYGPYWKQGMQNGYQDVGSWTFFKNTDPNRLAGAWLYAQF
VTSKTVSLKKSLTGLTFIRDSDINHDYLTKNAAKYGGLVEFYRSPARVAWTPTGNNVPDY
PKLAQLWWKNVATAVTGEKTPQAAMDNLAEEMDQVMARLQRAGMAQCAPKLNPKSDPSKW
LSADHAPWKKLDNEKPKGETIAYDKLLQAWKEGRVR
NT seq 1731 nt   +upstreamnt  +downstreamnt
gtgaagttggggatgtcggccctggcctttgcggccgcgctgacatgcgggcatgccgcg
tgggccgacgaggccgcggcgaagaagtggatcgacaacgaattccagccgtcgtcgttg
tccaaggacaagcagcaggccgagctgaagtggttcatcgacgccgccgccaagctcaag
gccaagggcgtgacgcagatcaacgtggtgtcggagacgattaccacgcacgagtacgaa
tccaagacgctggccaaggcgttcgaggaaatcaccggcatcaaggtcaaccacgacctg
atccaggaaggcgacgtcgtggaaaaactccagacgtcgatgcagtcgggcaagtcgatc
tacgacggctggatctcggactcggacctgatcggcacgcactaccgctacggcgccatc
ctgccgctgaccgactacatgaacggcgccggcaaggaattcaccaaccccggcatcgac
gtcaaggacttcatcggcaccaagttcacgaccgcgccggacggcaagctgtaccagttg
cccgaccagcagttcgccaacctgtactggttccgcgccgactggttcgcgcgcaaggac
ctgcaggacaagttcaaggccaagtacggctatgacctgggcgtgccgaccaactggtcg
gcctacgaggacatcgccaacttcttcaccaacgacgtgaaggaactggacggcaagaag
gtctacggccacatggactacggcaagaaggacccgtcgctgggctggcgcttcaccgac
gcctggctgtcgatggccggatcggccgacaagggcctgcccaacggcatgccggtggac
gagtggggcatccgcgtggccgacgacaagtgcacgccggtgggcgcgtcggtgtcgcgc
ggcggcgccaccaacagcccggcggccgtctatgcgctgaccaagtacatcgactggatg
aagaagtacgccccgccgcaggccatgggcatgacgttctccgaagccggcccggtgcct
gcgcagggccaggtggcgcagcagatcttctggtacacggcattcacggccgacatgacc
aagaagggcctgccggtggtcaacgccgacggctcgcccaagtggcgcatggccccgtcg
ccgtacggcccgtactggaagcagggcatgcagaacggctaccaggacgtgggctcgtgg
acgttcttcaagaacaccgacccgaaccgcctggccggcgcctggctgtacgcgcagttc
gtcacgtccaagacggtgtcgctgaagaagtcgctgaccggcctgacgttcatccgcgac
agcgacatcaaccacgactacctgaccaagaacgcggccaagtacggcgggctggtggag
ttctaccgcagcccggcccgcgtggcctggacgcccaccggcaacaacgtgcccgactac
cccaagctggcccagctctggtggaagaacgtggccacggccgtgaccggcgagaagacg
ccgcaggccgccatggacaacctggccgaggaaatggaccaggtcatggcccgcctgcag
cgcgccggcatggcgcagtgcgcgccgaagctcaacccgaagagcgacccgtcgaagtgg
ctgtcggcggaccatgcgccgtggaagaagctcgacaacgagaagccgaagggcgagacc
atcgcctacgacaaactgctgcaggcgtggaaggaagggcgggtgcgctga

DBGET integrated database retrieval system