KEGG   Cupriavidus pauculus: EHF44_13065Help
Entry
EHF44_13065       CDS       T05738                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
cpau  Cupriavidus pauculus
Brite
KEGG Orthology (KO) [BR:cpau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EHF44_13065
Enzymes [BR:cpau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     EHF44_13065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 DUF43 Glu_dehyd_C ThiF
Motif
Other DBs
NCBI-ProteinID: AZG14295
UniProt: A0A3G8H202
LinkDB All DBs
Position
1:complement(2487970..2488995)
Genome map
AA seq 341 aa AA seqDB search
MSLTCHIHASEDLRFSDVEPAAPGPHEVLVRLGAAGICGSDLHYYFHGKVGAFVIREPLT
PGHEASGIVEAVGSAVTRLAPGMKVAINPSHACGQCDYCRAGRDNLCRQMRFLGSASVYP
HVQGMFRQHFLMHEAQLTPVTADISLGELAFAEPLSVALHGVHRAGDLLGKTVLVTGGGT
IGSLAVMAARLAGAAKIVVCDIARRPLDVALSVGADEAILTTEAPASAWQDIADVSLEAA
GSPAALDTCLAATRRGGRIVQVGTLPAEGLHFPANNIMARELDYVGAFRFGREFDWAVQY
LTSRRLDVRPLLSAQLPLAQAAEAFRLAADKSRSTKVQLTG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgacctgccatatccacgccagcgaggacctgcgcttctccgacgtcgaaccg
gccgcgccgggcccgcacgaggtgctggtgcggctgggcgccgccggcatctgcgggtcg
gacctgcactactacttccacggcaaggtcggcgcgttcgtgatccgcgagccgctgacg
ccgggccacgaggcgtccggcatcgtcgaggccgtgggcagcgccgtcacgcgcctggcg
ccgggcatgaaggtggcgatcaacccgtcgcacgcgtgcggccagtgcgactactgccgc
gccggccgcgacaacctctgccgccagatgcgattcctgggcagcgccagcgtgtatccg
cacgtgcagggcatgttccggcagcactttctgatgcacgaggcacaactgacgccggtg
accgccgatatctcgctgggcgagctcgcgtttgccgagccgctgtcggtggcgctgcac
ggcgtgcaccgcgcgggcgacctgctgggcaagaccgtgctggtcacgggcggcggcacc
atcggcagcctggccgtgatggcggcccggctggccggcgcggcaaagatcgtcgtctgc
gacatcgcgcggcggccgctggacgtggcgctgtccgtgggtgccgacgaggcgatcctg
accaccgaggcgccagccagcgcgtggcaggacattgccgatgtcagcctggaagcggcc
ggcagcccggcggcgctggacacctgcctggccgccacgcggcgcggcgggcgcatcgtc
caggtcggcacgctgccggccgaggggctgcacttccccgccaacaacatcatggcgcgc
gaactcgactacgtgggcgcgttccgcttcggccgcgagttcgactgggccgtgcaatac
ctgaccagccggcggctcgacgtgcgcccgctgctgtccgcgcagctaccgctggcgcag
gcggcagaggcgttccggctggccgcggacaagtcgcgcagtaccaaggttcagttgacc
gggtga

DBGET integrated database retrieval system