KEGG   Cupriavidus pauculus: EHF44_14440Help
Entry
EHF44_14440       CDS       T05738                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
cpau  Cupriavidus pauculus
Pathway
cpau00440  Phosphonate and phosphinate metabolism
cpau01100  Metabolic pathways
cpau01120  Microbial metabolism in diverse environments
cpau01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    EHF44_14440 (aepX)
Enzymes [BR:cpau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     EHF44_14440 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 NTP_transferase IspD ICL
Motif
Other DBs
NCBI-ProteinID: AZG14538
UniProt: A0A3G8H247
LinkDB All DBs
Position
1:2808077..2809780
Genome map
AA seq 567 aa AA seqDB search
MNAIDPNLLGSATSAPLSRAARLRRMLLSDELEFIMEAHNGLSARIVREAGFKGIWASGL
AISAQFGVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGI
AGVCIEDKIFPKTNSFIGGEQQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWG
MEEALRRAEAYHQAGADAILIHSKLSKADEIVTFAREWGNRCPLVIVPTKYYSTPTDVFR
RAGISLIIWANHLIRVAASGMQAVAKDIYENQTLVNVEDRIATVNEIFRLQDADEYSAAE
KIYLTGGQAPGSAVVLAAGRGKGLEALTEDKPKVMLPVAGKPLLRWLVDGFKNQGINDIT
VVGGYKAEAIDAAGIHLVRNERHAETGELASLAAAADALQHDTVIAYGDLLFRSYILRDL
LETDAPFSVVVDSSESTPSNQSVRDFAWCSAADDRDLFGQKIVLKKISDDVPAGDAPHGR
WIGLMNVRGEGRARLQKLLAELRERPDFDKLDIPDLLNALVAAGEQVEVKYVHGHWRGVN
DLDDFRRAGDFAHGQTPFAVGGGEAAQ
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccatcgacccgaacctgctcggctccgccacctccgccccgctgtcgcgcgcc
gcgcgcctgcgccggatgctgctgtccgacgaactcgaattcatcatggaagcccacaac
ggcctgtccgcgcggatcgtgcgcgaggccggcttcaagggcatctgggcctcgggcctg
gccatctctgcccagttcggcgtgcgcgacaacaacgaggcaagctggacccaggtggtg
gacaaccttgagttcatggccgacgccagcgacctgccgatcctgctggacggcgacacc
ggctacggcaacttcaacaacgtgcgccgcctggtgcgcaagctggagcagcgcggcatt
gccggcgtctgcatcgaagacaagatcttcccgaagaccaacagcttcatcggcggcgag
cagcagccgctggccgacatcgacgagttctgcggcaagatcaaggccggcaaggattcg
caggcggacgacgatttctcgatcgtcgcccgcgtggaagcgctgatcgccggctggggc
atggaagaggcactgcgccgcgccgaggcgtaccaccaggctggcgccgacgcgatcctg
atccacagcaagctgtcgaaggccgacgagatcgtcacgttcgcgcgcgaatggggcaac
cgctgcccgctggtgatcgtgccgaccaagtactacagcacgccgaccgacgtgttccgc
cgtgccggcatcagcctgatcatctgggccaaccacctgatccgcgtggcggcgtccggc
atgcaggccgtggcgaaggacatctacgagaaccagacgctggtcaacgtggaagaccgc
atcgccacggtcaacgagatcttccgcctgcaggatgccgacgagtattcggcggccgag
aagatctacctgaccggcggccaggcgccggggtcggccgtggtgctggccgcgggccgt
ggcaagggcctggaggcgctgaccgaggacaagcccaaggtcatgctgccggtggccggc
aagccgctgctgcgctggctggtggacggcttcaagaaccagggcatcaacgacatcacc
gtggtgggcggctacaaggccgaggccatcgacgcggccggcatccacctggtgcgcaac
gagcgccatgccgagaccggcgagctggcgtcgctggccgccgccgccgacgcgctgcag
cacgacacggtcatcgcctacggcgacctgctgttccgcagctacatcctgcgcgacctg
ctggaaaccgacgcgccgttcagcgtggtggtggattcgtccgagtccacgccgtcgaac
cagagcgtgcgcgactttgcgtggtgctcggccgccgacgaccgcgacctgttcggccag
aagatcgtgctcaagaagatttctgacgacgtgccggcaggcgacgcgccgcacggccgc
tggatcggcctgatgaacgtgcgcggcgaaggccgcgcgcgcctgcagaagctgctggcc
gaactgcgcgagcggccggacttcgacaagctcgacatccccgacctgctcaacgcgctg
gtcgcggccggcgagcaggtggaggtcaagtacgtgcacggccactggcgcggtgtgaac
gacctggacgacttccgccgggccggcgacttcgcgcacggccagacgccgttcgcggtg
ggcggcggcgaggccgcgcaatga

DBGET integrated database retrieval system