KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0240Help
Entry
Cphamn1_0240      CDS       T00709                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00500  Starch and sucrose metabolism
cpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cphamn1_0240
Enzymes [BR:cpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Cphamn1_0240
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Cphamn1_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH hDGE_amylase Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: ACE03209
UniProt: B3EKY2
LinkDB All DBs
Position
230044..233361
Genome map
AA seq 1105 aa AA seqDB search
MPRASASYQPEPLWYKDAIIYEAHVKTFFDSNNDGVGDFEGLRQKLPYLESLGITAIWLL
PFYPSPLRDDGYDIADYMEVNPDYGTIEDFKAFLDDAHKLGLKVITELVINHTSDQHAWF
QRARQAEPGSVERDFYMWSSDPKKYSGVRIIFQDFEASNWTWDPVAGEYYWHRFYHHQPD
LNFENPAVEKAIYKVLDYWLEMGVDGLRLDAVPYLYAEEGTNCENLPRTHKFLQRLRKHV
DGKFPNRMLLAEANQWPEDAAEYFGEGDECHMNFHFPLMPRMYMALEMEDRFPIIDILDQ
TPGIPEECQWASFLRNHDELTLEMVTDEERDYMRRVYAHDPKARINLGIRRRLAPLMSND
RRKIELMNIMLLSLPGTPVLYYGDEIGMGDNFYLGDRDGVRTPMQWNGDRNAGFSRANPQ
QLQLPVIIDPEYHYEGANVEVQESNINSLLWWTRHMLSTSRRYKALSRGDIIFIQSQNPQ
VLIFTRTYKDETMLCIINLSRNAQAVTMDLSEYEGYIPEEVFSLSHFPGISARPYTVTLG
PYGYFWFKLVRSEDEIGSRRYIDKPFAKVAAMDDLFSGKVLDRLESRVLPQYIRGCRWFG
GKARKIVRVSVNDSIPVPACQNTVYLIVEVRYPSGSNDLYQLPVTFLPTGEFNPDEDFFM
KQVICSVKIGENEGYLCDATYQKEFHRFLLDVIIAGKGLKGGIFKLTAEKGSTLEEYLPQ
EEDDSMNSVIFGLEQSNTSIMYDDKLCLKLYRKISSGISPEVEICRTLTEKTSFESSPGY
LGALYLSRSRKDTSSLGILQNFIPNEGDAWSQTLHYVHRYYEEVLVLLPQLEEIPEIPPI
GGETVEMPEIMHGLIGEIYLGMVNKLAERTAEMHLSLASPDLGPDFLPEAFTTLYQRSIY
QSMREQVKRGMVMLKEQMKGIAKDYKGIAADLLGREQEILDRLSHIKARRIPASKIRIHG
DYHLGQVLWTGKDFVIIDFEGEPARSISERRIKRAVFRDLAGMMRSFHYAAFNVLIQDRS
IRPEDAEKLEPWAELWSFYTGQHFYDVYAAAVGGHGLIPENITEQHLLLRSYLMDKAIYE
LNYELNNRPEWVGIALKGLQRLLES
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgagcatctgcatcctatcagcctgaaccgctctggtacaaggacgccatcatt
tatgaggcacatgtaaagactttttttgacagtaacaatgacggtgtcggtgattttgaa
gggttgcgccagaagctgccctatctggaaagtctcggtataaccgcaatctggctgctt
cctttttatccttcacccctgagagatgacggctacgatattgccgattacatggaggtc
aatcctgactacggtaccatcgaggatttcaaagcctttctcgatgacgcgcataagctc
ggactgaaggtgattaccgagcttgtcatcaaccatacgtccgatcagcacgcatggttc
cagagggccagacaggcagagccgggatcggtcgaacgggatttttacatgtggagcagt
gatcccaagaaatactccggcgtccgcatcattttccaggatttcgaggcctcgaactgg
acatgggaccctgtcgccggagagtattactggcatcggttctatcatcatcagcctgat
ctgaacttcgaaaatcccgcggttgaaaaagccatttacaaggtgcttgattactggctg
gagatgggcgtcgacgggttgcggctcgacgcggttccctatctctatgcagaggaagga
accaactgtgagaaccttccccgcacgcacaagtttctgcagaggctgcgcaagcatgta
gacggcaagttcccgaaccgtatgcttcttgccgaggcaaatcagtggccggaagatgcc
gccgagtatttcggcgaaggtgacgaatgtcatatgaatttccatttccctctgatgccg
aggatgtacatggcgctggaaatggaagatcgttttccgatcatagatattctcgaccag
acacccgggattccggaagagtgccagtgggcttccttccttcgcaatcatgatgaactt
actcttgagatggtgaccgatgaggagcgtgactatatgcgccgggtgtacgcgcatgat
ccgaaggcgcgcatcaatctcggtatacgccgccgtctggcgccgcttatgtcgaatgac
cgcagaaaaatcgagctgatgaacatcatgctcctttccctgcccggcactccggttctc
tactacggtgacgagataggtatgggcgataatttttacctcggtgatcgtgacggcgtt
cgtactcccatgcagtggaacggtgaccggaatgcaggtttttccagagccaatccccag
cagttgcagctgccggtgatcattgatccggaataccattacgagggagccaatgtcgag
gtacaggaaagcaacatcaattcgctgctctggtggacacgccacatgctctccacctcc
cgcaggtacaaagccctcagtcgcggggatattatctttattcagtctcagaatcctcag
gtcctgatttttaccaggacatacaaggatgagaccatgctgtgcatcatcaacctgtcg
cgtaacgcacaggcggtcaccatggatctgtcggaatacgaaggatatattcctgaagag
gtgttcagcctcagtcattttcccgggatctctgcaaggccgtatacggttacgctgggt
ccttacggatatttctggttcaagcttgtcaggagtgaagatgagatcgggagccgacgc
tatatcgacaagccgtttgcgaaagtagccgccatggatgacctcttttccggcaaggtt
cttgaccgtcttgaatccagagtgctgcctcagtatatacggggttgcagatggtttggc
ggcaaggcccgcaagatcgtcagggtcagcgtcaacgatagcattcctgtgccagcctgt
caaaacacggtctacctgattgtcgaggtacgctatccgagcggctcgaacgatctgtat
cagcttccggtgacatttctgcctacaggagagttcaatcctgacgaagactttttcatg
aagcaggttatctgcagtgtgaagatcggagagaacgaggggtatctctgcgatgcgacc
tatcagaaggagttccatcgtttccttctcgacgttatcatcgccggaaaaggcctgaag
ggggggattttcaaactgacagccgaaaagggctcgactctggaggagtatctgccgcag
gaagaggatgatagtatgaactccgtgattttcggtctggagcagagcaatacgtcgatc
atgtatgatgacaagctctgtctgaagctctaccgcaagatctcttcagggatttctcct
gaagttgaaatctgccgcaccttgactgaaaagacatcgtttgagagttctccgggctat
cttggagcgctttacctttccagaagccgcaaggatacctcttctctgggcatcctgcag
aactttatccccaatgagggagatgcctggagccagaccctgcactatgtgcaccgttac
tatgaagaggtgcttgttctgttgccgcagctcgaagagatcccggaaattcccccgata
ggaggagagacagtcgagatgccggagatcatgcacgggctgataggtgaaatctacctc
gggatggttaacaagcttgctgagcgaacagcagaaatgcatctttctctggcctcgccg
gatcttggtcctgattttctgcctgaagcatttaccacgctctatcagcgctccatatac
cagtccatgcgtgaacaggtgaaaagaggtatggtgatgctcaaggagcagatgaaaggg
atcgcgaaagattataagggaatcgcggctgatctgcttggacgggagcaggagatactg
gaccggctttcacatatcaaagctcgcaggatcccggcatcaaagatcaggattcatggt
gactatcatctcggtcaggtactctggaccggtaaggattttgtgatcattgactttgaa
ggcgaaccggcacgctctatcagcgagcgcaggatcaagcgtgccgtgttccgtgatctt
gcaggaatgatgcggtcgttccattacgctgccttcaacgtcctgatccaggatcgttct
ataaggcctgaggatgctgaaaagcttgagccatgggcggagttgtggagtttttatacc
gggcagcatttctatgatgtgtatgcggccgctgttggaggacacggtctgattcctgaa
aatattacagaacagcaccttctgcttcgctcctatctcatggacaaggctatttatgaa
ttgaactatgagctgaacaaccgtcctgagtgggtaggcatagccctgaagggtctgcag
cggctgctcgaatcctga

DBGET integrated database retrieval system