KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_1462Help
Entry
Cphamn1_1462      CDS       T00709                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Brite
Enzymes [BR:cpb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cphamn1_1462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACE04388
UniProt: B3EJL9
LinkDB All DBs
Position
1585197..1585802
Genome map
AA seq 201 aa AA seqDB search
MAYTQPALPYAENALAPHISAETIGFHYGKHHATYISKYNGMVAGTPFDDQTIEDVIVAT
ANDPEKAGLFNNGAQAWNHSFYWNSLSPDGGGAPGGQIGEKINADFGGYDKFREELANAA
ATQFGSGWAWLVLDKGQLKIVKTANAQTPLTNGMFPILTIDVWEHAYYLDYQNRRPDYVS
AVIGELLNWNFAASNFEAAQV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttacacacaaccagccctaccctacgcagaaaacgctctcgcgcctcatatctca
gcagagaccataggttttcactatggaaaacaccacgccacgtatatcagcaaatataat
ggtatggtagcaggcactccttttgacgatcagactattgaagacgttatcgtagcaaca
gcaaatgatcctgaaaaagcaggtctgttcaacaatggcgcgcaagcgtggaaccacagt
ttctactggaacagcctttcacccgacggcggaggcgctccgggcggacagatcggcgag
aaaatcaatgctgatttcggcggttatgacaaattccgggaagaacttgcaaatgcagcc
gcaacgcagttcgggagcggttgggcatggcttgttcttgacaaggggcagctgaaaatc
gttaaaaccgccaatgcacagacccctctcaccaatggaatgtttccgatactgacgatt
gatgtctgggagcacgcctactatctcgactatcagaatcgtcgccctgattacgtttca
gcggttatcggagaacttctcaactggaacttcgctgcaagtaattttgaagccgctcag
gtatag

DBGET integrated database retrieval system