KEGG   Chlorobaculum parvum: Cpar_1151Help
Entry
Cpar_1151         CDS       T00725                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cpc  Chlorobaculum parvum
Brite
Enzymes [BR:cpc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cpar_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACF11557
UniProt: B3QNQ4
LinkDB All DBs
Position
1267584..1268186
Genome map
AA seq 200 aa AA seqDB search
MAYQQPALPYADNALEPHISANTIGFHYGKHHAAYVKNYNGLVEGTPFDSMSLEEVILKT
ADDASKVGVFNNGAQAWNHSFYWNCLSPNGGGEPTGDVAAKIVEDFGSVEKFKEELKTAA
ATQFGSGWAWLVLDNGTLKVVKTGNAQNPMTSGQTPLLCIDVWEHAYYLDYQNRRPDHVA
AVIDNLLNWEFVNENYKAAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcagcaacctgcactcccgtacgccgacaatgctcttgaaccgcatatttcg
gccaacaccattggttttcactatggcaagcaccatgcagcctacgtcaaaaattataat
ggccttgtcgaaggtacgccgtttgactcaatgagtcttgaagaggttatcctcaaaacg
gctgatgacgcttcaaaggtaggcgttttcaacaatggcgcacaggcttggaaccacagc
ttttactggaactgcctcagcccgaatggcggcggcgagccgaccggcgacgtagctgca
aaaatcgtcgaagatttcggcagcgtggagaaattcaaggaagagctgaaaaccgccgct
gcaacccagttcggcagcggatgggcttggctggtactcgacaatggcacgctcaaggtg
gttaaaaccggtaacgctcagaaccccatgaccagcggccagactcccctgctctgcatc
gacgtctgggaacacgcttactacctcgattaccagaaccgccgtcccgatcatgtagct
gcggtcatcgacaacctcctcaactgggagttcgtcaacgaaaactacaaggctgcaaaa
taa

DBGET integrated database retrieval system