KEGG   Chlamydia pecorum P787: CPE3_0561Help
Entry
CPE3_0561         CDS       T02853                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
cpec  Chlamydia pecorum P787
Pathway
cpec00061  Fatty acid biosynthesis
cpec00620  Pyruvate metabolism
cpec00640  Propanoate metabolism
cpec01100  Metabolic pathways
cpec01110  Biosynthesis of secondary metabolites
cpec01120  Microbial metabolism in diverse environments
cpec01130  Biosynthesis of antibiotics
cpec01200  Carbon metabolism
cpec01212  Fatty acid metabolism
Module
cpec_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cpec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPE3_0561 (accC)
   00640 Propanoate metabolism
    CPE3_0561 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CPE3_0561 (accC)
Enzymes [BR:cpec01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CPE3_0561 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CPE3_0561 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C RimK ATP-grasp_3 ATPgrasp_ST LAL_C2 ATPgrasp_Ter ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AGW39895
LinkDB All DBs
Position
complement(631753..633108)
Genome map
AA seq 451 aa AA seqDB search
MKKVLIANRGEIAVRIIRACHDLGLSTVAVYSLADQEALHVLLADEAICIGEPQAAKSYL
KISNILAACEITGADAVHPGYGFLSENSSFASICESCGLTFIGPSAESIATMGDKVAAKL
LAKKIKCPVIPGSEGIVQSESEGFKIAEQIGFPIVIKAVAGGGGRGIRIVKEKDMFYRAF
AAARAEAEAGFNNPDVYIEKFIENPRHLEVQVIGDKHGNYVHLGERDCTVQRRRQKLIEE
TPSPILSPEIRAKVGKVAVDLARSAGYFSVGTVEFLLDKDKKFYFMEMNTRIQVEHTITE
EVTGIDLVKEQILVAMGKRLPWKQKSITFSGHVIQCRINAEDPSNNFTPSPGRLDYFLPP
GGPSVRIDGACYSGYTIPPYYDSMVAKVITKGKDREEAIAIMQRALKEFHIGGVHSTIPF
HQFMLDNPKFLQLDYDINYVDNLLAQGTSLF
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtcttgattgctaatagaggagaaatcgcagttcgtattatacgggcatgt
catgatttagggctatctactgttgcggtttattctttagctgatcaagaagctcttcat
gtgttgcttgcagatgaggcgatttgcattggtgaaccccaagcagcaaaatcttattta
aaaatctccaatattttggcggcttgtgagattacaggagccgatgctgtccatcctggc
tacggttttttaagtgagaactccagttttgcttctatatgcgaaagttgtgggttaaca
tttattggtccaagcgcagaatctattgccactatgggagataaagttgctgcaaagctt
cttgcaaagaagattaagtgtcccgtaattcctggatctgagggtattgttcaaagcgaa
agcgaaggctttaaaattgcagagcaaataggattccctatagtgattaaagcagtcgct
ggaggtggaggtcgagggattcgtattgttaaagaaaaagacatgttttaccgtgcattt
gctgctgctagagcagaggcagaagcaggttttaataaccccgacgtgtatattgagaag
tttatagagaatccccgccatttggaagtgcaggtcattggagataaacacggaaattat
gtacatcttggtgagagggactgtactgtacagagacgtcggcaaaaacttattgaagaa
actccaagtcctattttgtctccagagattcgagcgaaagttgggaaggtcgctgtagat
ttagctcgcagtgcagggtatttttctgtgggtactgtagaatttcttttagataaggat
aagaagttctattttatggagatgaatacaagaatccaggtagagcatacgatcacagaa
gaagttacaggaatagatcttgttaaagagcaaattcttgtagctatgggtaagcgtctc
ccttggaaacaaaaaagtattacattctcgggccatgtcattcagtgccggattaatgct
gaagacccttcgaataattttactccttccccaggacgtttagattattttttaccccct
ggagggccctctgttcgtattgatggtgcatgttatagcgggtatactattcctccatac
tacgactctatggtggcaaaggttatcacaaaagggaaagatcgagaggaggctattgca
attatgcaacgcgccttgaaggagtttcatattggtggcgtgcactctacgattcctttc
catcagtttatgcttgataatcccaagtttctccagctggattacgatattaactatgtc
gataatctccttgcgcaagggacgtctttattttaa

DBGET integrated database retrieval system