KEGG   Corynebacterium pelargi: CPELA_03715Help
Entry
CPELA_03715       CDS       T05936                                 

Gene name
aroG
Definition
(GenBank) Phospho-2-dehydro-3-deoxyheptonate aldolase AroG
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cpeg  Corynebacterium pelargi
Pathway
cpeg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpeg01100  Metabolic pathways
cpeg01110  Biosynthesis of secondary metabolites
cpeg01130  Biosynthesis of antibiotics
cpeg01230  Biosynthesis of amino acids
cpeg02024  Quorum sensing
Module
cpeg_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cpeg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CPELA_03715 (aroG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CPELA_03715 (aroG)
Enzymes [BR:cpeg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     CPELA_03715 (aroG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2 Penicil_amidase
Motif
Other DBs
NCBI-ProteinID: QAU52022
UniProt: A0A410W7U2
LinkDB All DBs
Position
795777..797171
Genome map
AA seq 464 aa AA seqDB search
MCVSWTVDIPKDVLPDLPPLPDGLQQRFEDVVARDAKQQPSWDRHMADNVRKILESVPPV
VVAPEIRKLKEQLADVANGKAFLLQGGDCAETFESNTEPHIRANVKTLLQMAVVLTYGAS
TPVVKMSRIAGQYAKPRSSDLDGNGLPNYRGDLVNGVDATEEARRHDPARMIRAYANSSA
AMNLVRALTASGTADLSRLTEWNREFVAQSPAGARYEALAQEIERGLDFMNACGVHDDTL
RAADIFCSHEALVVDYERAMLRLAQNDEGETELYDLSAHQLWIGERTRGIEDFHVNFAAL
IANPVGIKIGPTCTPEEAVAYADKLDPNFEPGRLTMVARMGHDKIRSVLPGIIAAVENSG
HKVIWQSDPMHGNTHTASNGYKTRHFDKVIDEVQGFFEVHRALGTHPGGIHIEFTGENVT
ECLGGAEDITDVDLPGRYESACDPRLNTQQSLELAFLVAEMLRN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtgagttggacagttgatatccccaaagacgtgcttcccgatctgccaccgttg
cctgatggattgcagcagcgctttgaagacgtcgtcgcccgcgatgccaagcagcagccc
tcttgggatcgccacatggccgataacgtgcgcaaaattcttgaatccgtgcccccagtg
gtcgttgcaccggagatccgtaagctcaaagagcagcttgccgacgtcgccaatggcaaa
gcatttttactgcaaggcggagattgtgctgagacttttgagtcgaacacagagccacac
attcgcgccaatgtgaaaacgctgctccaaatggctgtggtgctcacctacggcgcatcc
accccagtggtgaagatgtctcgtatcgctggccagtacgcaaagccgcgttcctctgac
cttgatggcaatggtctgccgaactaccgcggcgacctggtcaatggtgtcgacgccact
gaagaagcgcgacgccacgacccagctcgtatgattcgtgcctacgcaaactcctccgcc
gccatgaacctggtgcgagcactcacggcttccggtactgcggatctttcccgcctgacc
gagtggaaccgtgaattcgtagcgcaatcgccagcgggtgctcgctatgaggcactggct
caagaaattgagcgcggtttggacttcatgaacgcttgtggcgtccacgatgacaccctg
cgtgcagcagatatcttctgctcgcacgaggccttggtcgtggactatgagcgcgccatg
cttcgcctcgcacaaaacgacgaaggcgagacagagctctacgatctctccgcccaccag
ctctggattggtgagcgcacccgcggcatcgaagatttccacgtgaacttcgctgccttg
atcgctaaccccgtgggcatcaagatcggcccgacctgtactccggaagaagctgtggcc
tacgccgacaagctcgaccccaacttcgagcccggccgcttgaccatggtggcaaggatg
ggccacgacaagattcgtagcgtcttgccgggcatcattgctgcagtggaaaactccggc
cacaaggtgatttggcagtctgacccaatgcacgggaacacccataccgcttcgaatggg
tacaagacccgtcactttgacaaggtgatcgatgaggttcagggcttcttcgaggtacac
cgcgctttgggcacgcaccctggtggtattcacatcgaattcaccggcgaaaacgtcacc
gagtgccttggtggcgccgaggacatcaccgatgttgatctgcccggccgctatgagtct
gcctgcgaccctcgcttgaacacccagcagtctttggaattggccttcttggttgcagaa
atgctgcgtaactaa

DBGET integrated database retrieval system