KEGG   Corynebacterium pelargi: CPELA_07055Help
Entry
CPELA_07055       CDS       T05936                                 

Gene name
gsiA2
Definition
(GenBank) Glutathione import ATP-binding protein GsiA
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
cpeg  Corynebacterium pelargi
Pathway
cpeg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cpeg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CPELA_07055 (gsiA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpeg02000]
    CPELA_07055 (gsiA2)
Transporters [BR:cpeg02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    CPELA_07055 (gsiA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 AAA_16 AAA_29 AAA_22 AAA_23 RsgA_GTPase DUF87 Mg_chelatase AAA_15 AAA_5 MMR_HSR1 PRK DUF3987 RNA_helicase AAA G-alpha APS_kinase Sigma54_activat NACHT FtsK_SpoIIIE AAA_7 AAA_33 AAA_24 Dynamin_N ATP-synt_ab ATPase NB-ARC T2SSE AAA_10 AAA_25 Zeta_toxin AIG1 AAA_19 AAA_30 Hpr_kinase_C
Motif
Other DBs
NCBI-ProteinID: QAU52673
UniProt: A0A410W9N5
LinkDB All DBs
Position
complement(1543338..1545002)
Genome map
AA seq 554 aa AA seqDB search
MNTQQPTPLLELEDLHIAFESSTGTVEAVRGANLKIYPGQSVAIVGESGSGKSTTAMAII
GLLPGTGKVTKGRITFEGKDITGLNDKEMQEYRGSMIGLVPQDPMSNLNPVWRIGTQIKE
ALKANNVVKASEMDAAVTQLLEEAGLPDAERRAKQYPHEFSGGMRQRALIGMGLAARPRL
LIADEPTSALDVTVQKRILDHLGTLTKDLGTAVLFITHDLGLAAERAEHLVVMHRGRIVE
SGPSLEILRDPQHPYTQRLVSAAPSLASSRIQSAKAAGVQAEEVLVAEHDVEAEDVIKVE
NLTKVFDVRGARGAKKQLRAVDDVTFGLREGTTLAIVGESGSGKSTVANMILKLLEPTSG
RVLYKGKDITKLSSKETFDMRRKLQVVFQNPYGSLDPMYSIYRCIEEPLVVHKVGNRKER
EQRVAELLDMVAMPRSAMRRYPNELSGGQRQRIAVARALALNPEVVVLDEAVSALDVLVQ
HQILQLLTELQEELHLSYLFITHDLAVVRQTADEVVVMEQGRLVERGTTDQIFADPQQEY
TRDLINSVPGLGLL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgcagcaacctactccactacttgagctcgaagatctccacatcgccttcgag
tcctccaccggcaccgtcgaggcggtacgtggtgcgaatctgaagatttaccctggtcaa
tccgtggcgattgtgggtgaatctggttccggtaaatccaccaccgccatggcgatcatt
ggtctgctgcctggaaccggcaaagtgaccaaggggcggatcacctttgagggcaaggac
atcaccgggctcaacgataaggagatgcaggaatatcgcgggtccatgattggccttgtg
cctcaagacccaatgagcaacctcaacccggtgtggagaatcggcactcaaatcaaagag
gcgctgaaggcaaataacgtagtcaaagcctccgaaatggatgctgcggtaacgcaattg
cttgaagaggccgggcttcccgacgcagaacgtcgcgcaaagcagtatccgcacgaattc
tccggcggtatgcgccagcgcgccttgatcggtatgggccttgccgctcggccgcgtttg
ctcattgctgatgaacccacctcggccctcgatgtgacggtgcagaagcggatcctggat
cacctcggcaccttaaccaaagacctcggcacagcagtgctctttattacccacgacctc
ggtcttgccgcagagcgcgccgaacatctcgtggtgatgcaccgcggccgcatcgtggaa
tctgggccttcgcttgagatcctgcgcgatccccagcacccctacacccaacgcctggtc
agtgccgccccctcgcttgcttcttcacgcatccaatcggccaaggccgcaggtgtgcaa
gcagaagaagtgctggtggctgagcacgacgtcgaagcagaagacgtgatcaaagttgag
aacctgaccaaggtattcgatgtgcgaggcgcccgaggtgctaagaagcaactgcgtgcc
gtcgatgacgtgaccttcgggctgcgcgaaggcaccacgctggcaatcgtgggtgaatcc
ggttcgggtaaatcgaccgttgccaatatgatcctgaaactgctggagccaaccagcggt
cgggtgctgtataagggcaaggacattaccaagctcagcagcaaagaaacctttgatatg
cgccgcaagctgcaggtggtcttccaaaacccctatggctctttggatccgatgtattcg
atttatcgctgcatcgaagagccattggtggtgcacaaggtgggtaatcgcaaagagcgc
gagcagcgcgtagccgagctgctggatatggtggcgatgcctcgttctgccatgcgcagg
tatcccaacgaactttctggtggccagcgccagcgcatcgcggtggctagagccctggca
ctgaacccggaagtggtggtgctcgacgaggcagtatcggcactcgatgtgttggtgcag
caccagatcctgcagttgctcacggagctacaagaagaactccacttgagctatctgttt
atcacccacgacctggccgtggtgcgtcaaaccgcagacgaggtcgtggtgatggagcag
ggtcgtttggtagaacgcggcaccaccgatcagatctttgctgatccacagcaggaatac
accagggatctgatcaactccgtgccaggcctggggctgctctaa

DBGET integrated database retrieval system