KEGG   Campylobacter peloridis: CPEL_1363Help
Entry
CPEL_1363         CDS       T03559                                 

Gene name
pglE
Definition
(GenBank) N-acetyl-hexosamine aminotransferase
  KO
K15910  UDP-N-acetylbacillosamine transaminase [EC:2.6.1.34]
Organism
cpel  Campylobacter peloridis
Pathway
cpel00520  Amino sugar and nucleotide sugar metabolism
cpel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CPEL_1363 (pglE)
Enzymes [BR:cpel01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.34  UDP-N-acetylbacillosamine transaminase
     CPEL_1363 (pglE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP DUF5329
Motif
Other DBs
NCBI-ProteinID: AJC85175
UniProt: A0A0A8GUE8
LinkDB All DBs
Position
1404557..1405717
Genome map
AA seq 386 aa AA seqDB search
MRFFLSAPHMSGKELEYIHKAFESNYIAPLGEFVNALEQSIKDYTKSSNALALNAATAAI
HLALRVLGIKENDVVLASSFTFIASVAPISYMNAKPVFIDCDETYNLDVNLLKKAIKESP
KKPKALILTHLYGNASKMDEIVQICKENEIFLIEDAAEALGSFYKGKALGTFGDFGVYSF
NGNKIITTGGGGMLVSENHANLEKARFYSTQARENYLHYEHKEYGYNYRMSNILGAIGTA
QMEVLDERVSKKREIYGWYKEFLSGTFTFLDELENTKSNRWLSTALLDFDKSKLNTYEKH
CICENKNVQIQDKILKIIQVLKDNKIESRPLWKPMHLQELYKGYDAYLNGNSEFFFSNGI
CLPSATTMSKADVEEVSTLILNTLKD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagattttttctatcagcaccgcatatgagcggaaaagaattagaatacatacacaaa
gcttttgaaagcaattatatagcacctttgggcgagtttgttaatgccttagaacaaagc
attaaagattatacaaaaagctctaacgctcttgctttaaatgctgctactgcagccatt
cacctggctttaagggttttaggtattaaagaaaatgatgtggtattagcttcaagtttt
accttcatagcttcagtagcgcctatttcttatatgaatgctaagcctgtttttattgat
tgtgatgaaacttataatttagatgtaaatttattaaaaaaagctatcaaagaaagtcct
aaaaagccaaaagctctcattttaacccatctttatggcaatgcttctaaaatggatgag
attgttcaaatttgtaaagaaaatgagatttttttaatcgaagatgctgctgaggctttg
ggaagtttttataaaggtaaagctttaggaacttttggggattttggagtatattctttt
aatggcaataaaatcatcaccacaggtggtggaggtatgcttgtaagtgaaaatcatgct
aatcttgaaaaagcaagattttatagcactcaagctagagaaaattatcttcattatgag
cataaagaatatggttataattatagaatgagcaatatcttaggtgcaattggcactgca
caaatggaagttttagatgaaagagtaagtaaaaagcgtgaaatttatggctggtataaa
gaatttttaagcggaacttttactttcttagatgagcttgaaaataccaagtcaaatcgt
tggttaagcactgctttgcttgattttgataaaagcaaactcaatacttatgaaaaacac
tgcatttgtgaaaataaaaatgttcaaattcaagataaaattttaaaaatcattcaagtt
ttaaaagataacaaaatcgaaagccgcccactttggaaacctatgcatttacaagagctt
tataaaggctatgatgcttatttaaatggcaatagtgagtttttctttagcaatggaatt
tgccttccaagtgcaactactatgagtaaagctgacgtagaggaagtttctactttaatc
ttaaacaccttaaaggactaa

DBGET integrated database retrieval system