KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111780019Help
Entry
111780019         CDS       T05351                                 

Definition
(RefSeq) histone deacetylase 5
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cpep01009]
    111780019
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cpep03019]
    111780019
   04131 Membrane trafficking [BR:cpep04131]
    111780019
   03036 Chromosome and associated proteins [BR:cpep03036]
    111780019
Enzymes [BR:cpep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     111780019
Protein phosphatases and associated proteins [BR:cpep01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111780019
Messenger RNA biogenesis [BR:cpep03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     111780019
Membrane trafficking [BR:cpep04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    111780019
Chromosome and associated proteins [BR:cpep03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     111780019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl kleA_kleC
Motif
Other DBs
NCBI-GeneID: 111780019
NCBI-ProteinID: XP_023516037
LinkDB All DBs
Position
LG18
AA seq 659 aa AA seqDB search
MDVHGSGPRKFDGGNGDSRRVGVLYDERMCKHHTPDGDYHPENPNRIRAIWNKLQSSGIL
QRCVVLNGKEAEDKHILAVHSKNHVDLIKNISSKEFDSRRDKIAAQLNSIYFNKGSSEAA
YLAAGSVIDVAERVAQGDLDSGIAIVRPPGHHAEHDEAMGFCLFNNIAVAASFILNERPD
LGIKKILIVDWDVHHGNATQKMFWRDPRVLFFSVHRHEFGSFYPATDDGYYTMVGEGPGA
GYNINVPWENGQCRDADYLAVWDHILLPVAKEYNPDMIIVSAGFDAAVGDPLGGCCVTPY
GYSIMLEKLMNLGQGKIVLALEGGYNLDSIATSTLACAELLVDGRTMNNSSETCPFESTW
RVIQAVRRELSPFWPMLSDELPDNLTSKKVPVPEVLLSSSDSEDEASDSRLKSLEEILQG
ITLSRVEVKEDSQGQAINVTIPWRLELSKTDIWYASFGSNMWRPRFLCYIEGGQVEGMKK
PCTGSMDKTPPKEMLWKIFPHRLFFGHEYTNIWGQGGAAFLHPESNSDEKSFLCLYRITL
EQFNDVLYQENSGSGFLSDNPLLDIANLNKLTGNASTSIEISTGQGWYHNLVYLGKEQEL
PIVTMTCSHLDMEDFKSGKVPLCAPAKGYVDTLVKGLAEGPLSKEEALVYIQKAVTKPL
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgcatggctctggacctaggaaattcgacggaggcaatggcgattcacggagg
gtaggggttttgtacgacgagaggatgtgcaagcatcacacgcccgacggagattaccat
cctgagaatcccaatcgaattagggccatttggaacaagctacaaagctccggcattctt
cagaggtgtgtggtcttgaatgggaaagaagcagaagataagcatattttggcagtacac
tccaaaaatcatgttgacttgattaagaatataagctccaaagagtttgattcacgaaga
gataagattgccgcacaacttaactccatatactttaataaaggatcatcagaagctgct
tatctagctgctggctctgtcatagatgttgctgaaagagtagctcaaggagatttagat
tccggaattgccattgtgaggccaccgggtcatcatgccgaacatgatgaagctatgggg
ttctgtttgttcaacaatatagctgtggcagcaagctttattttgaatgaacgacccgat
ttgggtattaagaagatattaattgttgattgggatgttcatcatggcaatgcaacacaa
aagatgttctggagggatccccgtgttttgttcttctccgttcaccggcacgagttcgga
agcttttatcccgccacagatgatggttactataccatggttggagaaggaccaggagca
ggatataatataaatgtcccttgggagaatggacaatgtcgggatgctgattacctagct
gtttgggaccatatcttgcttccagttgctaaggaatataatcctgacatgatcatagtc
tctgccggatttgatgcagctgttggagatcctctaggtggttgctgtgtcacaccgtat
ggatactcaattatgttggaaaagttgatgaatcttggtcaaggaaagattgtattggca
ttggaagggggatataatcttgactctatagcaacttcaacgcttgcctgtgcggaactt
ctggttgatggaagaactatgaacaattcttcagagacttgtccatttgagtcaacatgg
cgagtgatccaagcagttcgccgagaattgagtcctttttggccaatgctttcggatgaa
ctaccagataatttaaccagtaaaaaagtgccagtcccggaggtattgctttcaagctct
gattcagaggatgaagcttccgattctcgattaaaaagcctcgaggaaattcttcagggt
atcacactttcacgagtggaagttaaggaagacagtcagggtcaagcgattaatgttact
atcccttggagattggagctctcaaaaactgatatctggtatgcttcatttggatcaaat
atgtggcgcccgagattcctctgttatatcgaaggaggacaggttgagggtatgaaaaaa
ccgtgtacgggttcaatggataagacaccaccaaaagagatgctgtggaaaatttttcct
caccgtctatttttcggtcatgaatataccaatatatggggccaaggaggagctgctttt
cttcatcctgaaagcaacagtgatgagaaatctttcttgtgcttgtatagaataacgcta
gagcaattcaacgatgttttgtatcaagaaaacagtgggagtggcttcctttctgataac
cctttattggatatagctaatctgaacaaactcacaggcaacgcttccacatctattgag
atttcaacagggcaaggatggtaccacaaccttgtatacttggggaaagaacaggaactt
ccgatagtaactatgacatgttcgcatttggatatggaagacttcaaatctggaaaggtt
cctctctgtgcaccagccaaagggtacgttgatacccttgttaaaggccttgctgaagga
ccactttcgaaagaggaagctttggtttacattcagaaggctgtaactaagccactgtaa

DBGET integrated database retrieval system