KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111783419Help
Entry
111783419         CDS       T05351                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00052  Galactose metabolism
cpep00500  Starch and sucrose metabolism
cpep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111783419
   00500 Starch and sucrose metabolism
    111783419
Enzymes [BR:cpep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     111783419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 BON
Motif
Other DBs
NCBI-GeneID: 111783419
NCBI-ProteinID: XP_023520110
LinkDB All DBs
Position
LG20
AA seq 937 aa AA seqDB search
MDSDIFCKKIRRRTHPYSSTTMATGSKSLQAFLRRRRLLSAVVLFLFTCFFRLTASLPFA
AGEQRENSAVGYGYRVRSGRVDPTGKSLTADLDLIEKSSVYGPDVERLSIQASFETKDRL
RVRITDSNRERWEVPDEIIPRRSNSRIRSLPERDVGSPETSVISDPASDLIFSLHDTAPF
GFSVHRRSSGDVLFDTSPNFSDSETFLVFKDQYIQLSSSLPKDRSSLFGIGEQTRKSFKL
VPDKSKTLTLWNADIGSVNTDVNLYGAHPFYIDVRSPSRDGKVAAGTTHGVLLLNSNGMD
IIYSGDRISYKAIGGIIDLYFFAGPSPISVIDQYTELIGRPAPVPYWSFGFHQCRYGYKN
VSDIETVVARYAKAGIPLEVMWTDIDYMDGYKDFTFDPINFPVEKMKNFVDNLHQNGQKY
VLILDPGISTNKTYGTYIRGIEADIFIKYDGVPYLGEVWPGPVYFPDFLHPNSEIFWGDE
IKLFRDIVPFDGLWIDMNEISNFITSSTSSFSNLDNPPYKINNAGVQRPINNRTVPASSL
HFGNLTEYNTHNLYGFLESKATHASLVKVTGKRPFVLSRSTFVGSGKYTAHWTGDNAATW
NDLGYTIPSILNFGLFGIPMVGADICGFSRDTTEELCRRWIQLGAFYPFARDHSDKGSIR
QELYLWDTVAASARKVLALRYSLLPYIYTLMYEAHKKGTPIARPLFFSFPQDIRTYEINS
QFLLGAGVLISPVLKEGAISVDAYFPAGNWFSLFNYSESVAVNSGQQITLDAPADHINVH
VREGNILALHGEATTTQAARKTAFKLLVVVSNGQSSSGEVFLDDGEVVEMGEEGGNWSLV
RFYSEAVGSKLLIKSQVINGGFALSQKMIIDKVTIVGFERPKNMGGLGLDISKGANLDGN
SGIRKTYEYSAKFVNVEISGLSISIWEEFVMELSPLN
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggatagtgacattttttgcaagaagataagaagaagaactcacccttacagctcgaca
acaatggcgactggttccaaatctctccaagcttttctccgtcgccgtcgtttactctcc
gccgtcgtactcttccttttcacttgcttctttcgtctaactgcatctctcccgttcgcc
gccggcgagcagagagaaaactcggccgtcggatatggataccgagttagatcggggcgt
gttgaccctaccggaaagtcgttgaccgccgatcttgacctgatcgaaaaatcgtccgtc
tacggacctgacgttgagagacttagcatccaagccagttttgaaaccaaagatcggctg
agagtgcgaataacagactcaaatcgggaacgatgggaagtaccggacgagataattccc
cgtcgatcgaactcccgtatccgctccctgccggaaagagacgtcggctcaccggaaacc
tctgtcatttccgatccggcttccgatctcattttcagcctccacgacaccgcaccgttc
ggcttttccgtgcaccggcgatcatctggcgatgtcctcttcgacacatcgcctaatttc
tccgattcggagacttttcttgtcttcaaggaccaatacattcaactatcctcttcgctt
cccaaggacagatcgtctttgtttggcattggcgagcaaaccaggaagtcgttcaagctc
gtgccggataaaagtaaaactttgacgctttggaacgccgatatcggtagtgttaatact
gacgtgaacctctatggtgctcatcccttctacattgacgtccggtcgccgtctcgcgat
ggtaaagttgcggcagggacgacgcatggagttctgttactgaacagtaatggtatggat
attatatacagtggagataggattagctacaaggctattggtggaatcattgatttatac
ttctttgcgggtccgtcaccgatatcagtgatagatcagtatacggagcttattgggcgg
cctgcacccgtgccttattggtcgtttggttttcaccaatgtcgttatggctacaagaat
gtttctgatattgagactgtagttgctcgttatgccaaagccggcatacctcttgaagtt
atgtggacagacattgattacatggatgggtataaggacttcacttttgatcccatcaat
tttcccgtggagaaaatgaagaactttgttgataatcttcatcaaaatggacaaaaatat
gtgctcatcttggatcccggtattagtacaaacaagacatatggaacatacatccgaggg
atagaagctgatatctttataaaatatgacggggttccatacttgggtgaggtttggcct
ggacctgtttacttccctgattttcttcatccaaacagtgagattttctggggtgatgag
attaaattatttcgagatattgttccgtttgatggtctttggattgatatgaatgagata
tcaaattttataacctcttcaaccagctcattttctaatcttgataaccctccttacaag
attaacaatgctggagtccaacgtccaattaacaataggactgtgccagcatcaagtctt
cattttggtaacttgacagagtataatactcataacttatatggtttcttggagtcaaag
gctactcatgcctcattagtaaaagtaacgggcaaaagaccatttgttctgtcaagatca
acttttgtaggctctgggaagtacacagcacattggaccggagataatgctgcgacttgg
aatgatttaggttacacaattccatccattttgaactttggactctttggaattccaatg
gttggtgctgacatatgtggattttctagagatacgacggaagagctttgccgacgttgg
attcagttaggtgcattttacccatttgctagagatcattctgacaaaggatccattcgt
caagagctttatctttgggatacagttgctgcatcagccaggaaggtgcttgcacttcgc
tatagcttacttccttacatctacacgttgatgtatgaggcacacaaaaaggggacacca
attgcacgccctctcttcttctcattccctcaggatatcaggacctatgaaatcaactcc
cagtttctacttggagcaggtgtattgatttctccagttctgaaggagggagctatttct
gttgatgcatattttcctgcaggaaactggtttagcctctttaactattccgagtcagtg
gctgtaaattcagggcagcaaatcactctagacgcacctgctgatcatataaacgtgcac
gtcagggaaggaaacatattggcattacacggagaggcaacgacaacacaagcagctcga
aagacagcgttcaagcttttggtagtcgtcagcaatggtcagagcagctctggagaggtg
ttcttggatgatggagaagtggtggaaatgggagaagagggaggtaattggagtctggta
agattttacagtgaagcagttgggagtaagttactgatcaaatctcaggtcataaatgga
ggatttgctttgagccagaagatgatcattgacaaggtgaccattgtaggctttgaaagg
cctaagaacatgggtggccttggcttagatataagcaagggcgcaaacttggatggtaat
tcaggcatcagaaaaacgtatgagtactctgccaagtttgttaatgtcgagatctcgggc
ttgtccatttctatttgggaggaattcgtaatggaattgtcaccattaaattga

DBGET integrated database retrieval system