KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111784481Help
Entry
111784481         CDS       T05351                                 

Definition
(RefSeq) protein SET DOMAIN GROUP 41 isoform X1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00310  Lysine degradation
cpep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111784481
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cpep03036]
    111784481
Enzymes [BR:cpep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     111784481
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     111784481
Chromosome and associated proteins [BR:cpep03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111784481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 111784481
NCBI-ProteinID: XP_023520942
LinkDB All DBs
Position
Unknown
AA seq 623 aa AA seqDB search
MEMEMRAMEDIEMAEDITPPLPPLTAALHDAFLLTHCSSCFSPLPNSSISHSNLLRYCSP
ICSHSDSLTAAVFSTGQFPFSDTSDLRASLRLLHLLLSDPSAWRSAPPERIFGLLTNREK
LMLADDDSEVFVKIREGSDAMAASRRTNSADIRYDNALEEAILCLVLTNAVEVQDSVGRT
IGIAVYHPTFCWINHSCSPNACYRFETPSDSIKTRLRISPFCTDIGTGEGSCSQMSTVRR
NFSHFITKDFQGYGPRVMVRSIKSIRNGEAVTIAYCDLLQPKAMRQSELRSRYKFVCSCQ
RCSAKPPTYVDHALQEISAVNVELLDSTSISNFDYDTAIARIDDYVNNAIAEYLSIGSSE
SCCEKLQNLLTLGFYDEQAEDGDGKQLLNLRLHPVHFLLLNAYTALASAYKVRSWNGDEN
QCNATMSKTSAAYSLFLAGATHHLFLSEPSLIASAANCWVVAGESLLILVKHSSLWGSNT
SKSSSPMGEITCLNCSWVDKFNTSRIHGRSIEADFREFSIGISNCIANISQKYWSFLAHE
CSYLKAFTDPFDFSWPKTITTCSNYRDRSCDCSKIQDVSDQDRQSIFELGIHCLFYGGYL
ASICYGHHSHLASQIQCILHDMN
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggagatggaaatgagagcaatggaagacatagaaatggcggaagacattactccgccg
ttgcctcccctcaccgccgctctccacgatgccttcctcctcactcactgctcctcctgt
ttctcccctctcccaaattcctcaatttctcactctaatctcctccgctactgctcccct
atatgctcccattccgattccctcaccgccgccgtcttctccaccggtcagttccccttc
tccgacacctccgacctccgcgcctccctccgcctcctccacctccttctctctgatccc
tccgcttggcgctctgctcctcccgagcgtatctttggccttctcaccaatcgggagaaa
ttgatgcttgctgatgacgattccgaggttttcgtcaagattcgggaagggtccgacgcc
atggccgcttccagacggacgaactctgccgatattcgctatgacaacgccttggaagag
gctatcctgtgccttgtcttgaccaacgccgtcgaggttcaggattcggttggccgaacc
attgggattgctgtgtaccatccaactttctgctggatcaatcacagttgttctcccaat
gcttgttacagatttgaaactccgtcggattccatcaagacgaggctacggatttccccc
ttctgtactgacattggtactggtgaaggaagttgcagtcaaatgagtactgttcgtaga
aacttttcgcatttcattacaaaagattttcagggttatggtccaagagtcatggttagg
agtataaagagtataaggaatggcgaagcagtcacgattgcatactgtgacttgttgcaa
cccaaggcaatgaggcagtcagaattgcgatcaagatataaatttgtctgcagttgccag
cgatgtagtgccaagcccccaacttatgtggaccatgctttgcaagaaatctctgctgtc
aatgtggaattgcttgattcaacttccattagcaactttgattatgacactgcaatagca
agaatagatgattatgtcaacaatgccatagctgagtacctgtctattggttcctctgaa
tcatgttgtgagaagcttcaaaacttgcttactttaggtttctacgacgagcaagcggaa
gacggggacggaaaacagcttcttaacttaaggctgcatcccgtgcacttcctgttgctg
aacgcgtacactgctctagcatcggcttacaaagtccgttcatggaatggcgatgaaaat
caatgcaacgctacgatgagcaaaacaagtgcagcttactccttgttccttgcaggtgct
actcatcatctttttctttctgaaccgtctttgattgcttctgctgcaaattgttgggtt
gttgctggagagtctttgctcattcttgttaaacatagctcattatggggctccaacact
tcaaaatcgagctcccctatgggcgaaataacgtgtttaaactgctcatgggtcgataag
ttcaatacgagtagaatccatggtcgatctatagaagcagattttcgggagttttcgatt
ggtatttctaattgcattgctaatatttcacaaaaatattggagctttctggctcatgaa
tgctcatatttgaaggctttcactgacccctttgatttcagctggccgaagacgatcacg
acatgttcgaattaccgtgatcgttcgtgtgattgtagtaaaattcaagatgtttctgac
caagacaggcaatctatctttgagcttggtatccattgcttattctatggaggttattta
gcaagtatttgttatggtcaccattcacatttggcatcccagattcaatgtattttacat
gacatgaactga

DBGET integrated database retrieval system