KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111785901Help
Entry
111785901         CDS       T05351                                 

Definition
(RefSeq) glucomannan 4-beta-mannosyltransferase 2-like
  KO
K13680  beta-mannan synthase [EC:2.4.1.32]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cpep01003]
    111785901
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpep02000]
    111785901
Enzymes [BR:cpep01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.32  glucomannan 4-beta-mannosyltransferase
     111785901
Glycosyltransferases [BR:cpep01003]
 Polysaccharide
  Structural polysaccharide
   111785901
Transporters [BR:cpep02000]
 Other Transporters
  Others
   111785901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_trans_2_3 Glyco_tranf_2_3 Glycos_transf_2 Glyco_transf_21 FlaG Chitin_synth_2
Motif
Other DBs
NCBI-GeneID: 111785901
NCBI-ProteinID: XP_023522032
LinkDB All DBs
Position
Unknown
AA seq 542 aa AA seqDB search
MAEASQVLLPESFQGGRGDFTDQIWLIWDLIKAPLIVPVLRLMVYISLAMSLMLFFERLY
MGIVIILVKLFWKKPEKRYNYEPIQDDLELGSSNFPHVLIQIPMFNEREVYKISIGAACG
LSWPADRLVIQVLDDSTDPVIKQMVEQECLRWASKGINITYQIRETRGGYKAGALKEGLK
RRYVSHCEYVAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNANECLLTRMQEM
SLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGW
KFVYLGDLQVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVKFWKKVYVIYS
FFFVRKIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSVITILNSVGTPRSIHLLF
YWILFENVMSLHRTKAALIGLFEAGRVNEWVVTEKLGDALKNKAAADAAKNKANAKVPKI
RLRCKFGDRINTLELGFAAFLFFCGCYDFVHGKNNYFVYLFLQTFSFLITGVGYVGTIIP
SS
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcttcacaggttctcttaccggagtcgtttcaaggtggaagaggcgatttc
actgaccaaatttggctcatatgggacctcatcaaagcgccattgatagttcctgtgctt
agattaatggtttatatctcattggcaatgtctctcatgcttttctttgaaaggctttat
atgggaattgtcattattctggttaagctcttttggaagaaacctgagaaacgttacaat
tatgaacccattcaggatgatttggaattgggaagctccaatttccctcatgttcttatt
caaatcccaatgtttaacgaacgagaggtttacaaaatctccattggagctgcttgtggt
ctttcatggccagccgaccgcctcgtcattcaagttcttgacgattcaaccgacccagta
attaagcaaatggtggagcaagaatgcctgagatgggcgagtaaagggattaacataacg
tatcaaatcagggaaaccagaggagggtacaaagctggagctctgaaagaagggcttaaa
cggaggtatgtcagccattgtgagtatgtcgccattttcgacgccgatttccggccggag
ccggactatctccggcgagccattccgttcttagttcataatcctgatatcgccctcgtt
caagctcgatggagattcgtgaatgcaaatgagtgcctgctgacaagaatgcaagagatg
tcattggattaccatttcacagtggagcaagaagttgggtctgctacccatgccttcttt
ggcttcaatggaactgctggagtgtggagaattgctgcaatcaatgaggcaggtgggtgg
aaggacaggaccaccgtggaagacatggaccttgccgtccgagctagtcttagagggtgg
aaatttgtctacttaggtgacctgcaggtaaaaagtgagcttcctagtactttcaaggcc
ttccgtttccagcagcatcgatggtcttgtggccctgccaatcttttccgcaaaatggtc
atggaaattgtcagaaacaagaaagtgaaattctggaagaaagtttatgtgatctacagt
ttcttctttgtccggaagatcattgcccatatggttactttcttcttctactgtgttgtt
cttcccctcaccattttggttcctgaagtgtatgtaccaatttggggagctgtttacatt
ccttccgtcatcaccattttgaactcggtcggaaccccaaggtcgattcaccttctgttc
tactggatccttttcgagaacgtgatgtcgttgcaccgcacgaaagcagctctaatcggt
ttattcgaagcgggtcgagtgaacgaatgggttgtgactgaaaagctaggagatgctctg
aagaacaaggcagctgctgatgctgcaaagaacaaagcaaacgccaaagttcccaaaatt
agactaagatgcaagtttggtgacagaatcaacacattggagctgggatttgcagcgttc
ttgttcttttgtgggtgctatgactttgttcatgggaagaacaactacttcgtgtacctt
tttcttcagacattcagctttctgatcactggagttggatatgtcggaaccatcatccca
agctcttaa

DBGET integrated database retrieval system