KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111787710Help
Entry
111787710         CDS       T05351                                 

Definition
(RefSeq) DNA ligase 6-like isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep03030  DNA replication
cpep03410  Base excision repair
cpep03420  Nucleotide excision repair
cpep03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111787710
   03410 Base excision repair
    111787710
   03420 Nucleotide excision repair
    111787710
   03430 Mismatch repair
    111787710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cpep03032]
    111787710
   03400 DNA repair and recombination proteins [BR:cpep03400]
    111787710
Enzymes [BR:cpep01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111787710
    6.5.1.6  DNA ligase (ATP or NAD+)
     111787710
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111787710
DNA replication proteins [BR:cpep03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111787710
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111787710
DNA repair and recombination proteins [BR:cpep03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111787710
   NER (nucleotide excision repair)
    Other NER factors
     111787710
   MMR (mismatch excision repair)
    Other MMR factors
     111787710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DRMBL RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 111787710
NCBI-ProteinID: XP_023523509
LinkDB All DBs
Position
LG02
AA seq 621 aa AA seqDB search
MASESSTAKPLAIDSSLSFVTAIESFSRQLNLSLPPLKLPFRPPPLPADFPQSKLIPKSR
FVVDAFSHAGEFSVSYFLSHFHSDHYAGLSPTWCKGIIFCSDVTARLLLEVLKVPLPFVQ
SLPLREPVVIDGCEVILIDANHCPGAVQFLFKIPSADEKFERYVHTGDFRFCDSMIIDPV
LKTFIGSDAVFLDTTYCNPKFIFPSQDESIEYIVNMIQKIGGESKGSMGSVLFLIATYVI
GKEKILLQIASRCNRKIMVDARKMKVLRILGYGGESGVFTEHENESDVHVVGWNVLGEFW
PYFRPNFDRMNDIMVEKGYSKVVGFVPTGWTYEMKHKNFSVRSKDSLEIHLVPYSEHSNY
NEIREFVKFLKPRRVVPTVGLDVDKLDSKHADKIRKHFGGLVDEMANRKEFLKGFHRGEM
SDGIDETATMTVNEDLEEMETVSETCGSSMALSSLQEVGSTDRSVLNDEEQKKIIQELRE
CLPAWVTQDQILELISRSGRNVVDAVSNFYEQETEFYEHIATLPDNLPKFQGKVVDSPLP
FTFPARDDIKKNVFLGNFDVSSGQDSKSSSPRGKMTSKSKASPGKRKRNLQGKPKSKSKK
NSSLQSDGSKQSTITKFFGKA
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgaatcttccaccgctaaacccttagcaatcgactcatccctctccttcgtc
actgccattgaatccttttcacggcaattgaatctctctcttcctcctctgaagctccca
ttccggccgcctccattaccggccgatttcccccaatccaaactcattcccaaatcccgt
ttcgtcgtcgacgcattttctcacgctggtgagttctctgtttcctatttcctttcccat
tttcactccgatcactatgccggtctctcccctacttggtgcaagggtatcatcttctgc
tctgatgttaccgcccgccttttgcttgaagttctcaaagtcccgttgccgtttgttcaa
tcattgccgcttcgggagcctgtagtaatcgatggatgtgaggtaatacttattgatgct
aaccattgtcctggtgcggtgcagttcttgtttaagattcctagtgcggatgaaaagttt
gagagatatgttcatactggggattttcggttttgtgactctatgataatcgaccctgtt
ttgaaaacgtttattggctcggatgcagttttcttggacactacttattgtaatccgaag
tttatttttccttctcaggatgagtctattgaatatattgtaaacatgatacaaaaaatt
ggaggtgaaagtaagggttctatggggagtgttcttttccttatagcaacttatgtaatt
ggtaaggaaaaaattttgcttcaaattgcaagtagatgtaatcgtaagataatggtggat
gctaggaaaatgaaagttttacggattttggggtatggtggtgagagtggggtgtttact
gagcatgaaaatgaaagtgatgttcatgttgttggatggaatgttttgggtgagttctgg
ccttattttaggcctaattttgatagaatgaatgatataatggtggaaaaggggtattct
aaggttgttggttttgttccaacagggtggacttatgagatgaaacacaagaacttctca
gtaaggtctaaggattcgcttgagatacatttggtgccatatagcgaacattcaaactat
aatgaaattagggaatttgttaagtttttgaagcctagaagagttgttcccactgtaggt
ttggatgttgataaacttgatagcaagcatgctgataagattaggaagcattttggtggt
ttagttgatgaaatggccaacagaaaagaattcttaaaagggtttcatcgtggagaaatg
agtgatggtattgatgaaactgccacaatgactgtaaatgaggacttggaagagatggaa
actgtatcagaaacatgtggtagtagtatggcgttgtcttctctgcaagaagttggttct
accgatcgatccgtgttgaatgacgaggagcagaagaagattatccaggaacttcgtgag
tgcttgcctgcatgggtgactcaggatcagatattagagctgattagcaggtctgggaga
aatgtggttgatgcagtttctaatttctatgaacaagaaactgaattttatgaacatatt
gctactctcccggacaaccttcccaagttccagggcaaagttgtagatagcccattgcca
tttacttttcctgcaagagatgatattaaaaagaatgttttcttgggaaattttgacgtt
tcttcaggccaagattcgaagtcgtccagtccaaggggcaagatgacgagcaagagcaaa
gcttctcctggaaaaaggaagagaaatcttcagggtaagccgaaaagtaagtcgaaaaag
aattcaagtctgcaatctgatgggtcaaagcaatctacaatcacaaagttcttcgggaaa
gcttga

DBGET integrated database retrieval system