KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111789077
Entry
111789077         CDS       T05351                                 

Definition
(RefSeq) cytochrome P450 86A1-like
  KO
K15401  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00071  Fatty acid degradation
cpep00073  Cutin, suberine and wax biosynthesis
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111789077
   00073 Cutin, suberine and wax biosynthesis
    111789077
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cpep00199]
    111789077
Enzymes [BR:cpep01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     111789077
Cytochrome P450 [BR:cpep00199]
 Cytochrome P450, plant type
  CYP86 family
   111789077
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 111789077
NCBI-ProteinID: XP_023525487
LinkDB
Position
LG02
AA seq 520 aa
MANDVVLPFPFPSFLLLIFAYLIWFHFLARTLTGPRVWPVIGSLPALISNRRSLHDWMAG
NLRSTGGAATYQTCTVALPFFARKQGFYTVTCHPRNIEHVLRTRFENYPKGPDWQAAFHD
LLGQGIFNSDGEIWLVQRKTAALEFTTRTLRQAMDRWVNRTIRTRLWCILDKAAEYKTAV
DLQDLLLRLTFDNICGLTFGKDPQTLSPELPASPFALAFDSATEATLHRLLYPSILWRLK
KLLGIGMERRLKESLKVIEEYINDAVASRKESPSDDLLSRFMKKKHDGDGDGDGNRFSAA
VLHRIALNFVLAGRDTSSVALTWFFWLVMNHPHVEAKILAEISTVLRQTRGEDPRRWIEE
PLMFDEADKLVYLKAALAETLRLYPSVPQDFKYVVADDVLPDGSFVPAGSTVTYSIYSAG
RMKSIWGEDCGEFKPDRWLSPDGDRFEGPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVAS
AVLLRYQLAPVPGHRVEQKMSLTLFMKNGLRVYLHPRRLG
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggctaacgacgtcgttttgcccttccccttcccctcttttcttctcctcattttcgcc
tatttgatttggtttcatttcctcgcccgtacgctaaccggtccaagagtctggccggtc
ataggcagcctaccggctctcatctcgaatcggcggagcctccatgactggatggctggg
aacctccgctccacaggcggcgccgccacataccaaacttgtacggtggcacttccattc
ttcgctagaaaacaaggcttctacacggtcacgtgccacccgagaaacatcgaacacgtg
ctccgaacccggttcgaaaattacccgaaaggaccggactggcaagcggcttttcacgat
cttttaggtcaagggattttcaacagcgacggcgagatttggctggtccagcggaagacg
gcggcgctggagttcacgacgaggacgctacggcaggcgatggaccggtgggtgaatcgc
acgataaggacgcgactttggtgcatattggataaggcggcggagtataaaacggcggtt
gatttgcaggatttgttgctccggttgactttcgataacatttgtgggctcacttttggg
aaagatcctcaaactttgtcgccggaattgcctgcaagtcccttcgctttggcgtttgat
tccgccactgaagccactcttcaccgccttctttaccctagcattttatggaggttaaag
aagcttctgggcatcggaatggaaagaaggttaaaggagagtttaaaagtaatagaggaa
tacataaacgacgccgttgcatcccgtaaagaatccccctcagacgacttattatcccgc
ttcatgaagaagaagcacgacggcgacggcgacggcgacggcaaccgcttctccgccgca
gtgctccaccgcatcgccttaaacttcgtcctcgccggccgggacacatcctccgtggca
ctcacgtggttcttttggctcgtaatgaatcacccgcacgtggaggctaaaatcctcgcc
gaaatctcaacggttctccgccagacacgcggcgaggatccacgacggtggatcgaagag
ccgttgatgttcgacgaggccgataaattggtgtatttaaaagccgcgctggccgaaacg
ctgcgtttatacccgtccgtaccgcaggatttcaaatacgtcgtggctgatgacgtgttg
ccagatggcagttttgtgccggccggttcgaccgtgacgtattcgatttattcggccggg
aggatgaagagcatttggggggaggattgtggggaatttaaaccggaccggtggctgtcg
ccggacggggaccggttcgaggggccgaaagatgggtataaattcgtggcgtttaatgct
ggaccgagaacttgtttggggaaggatttggcttatttgcaaatgaagtccgtcgcctcc
gccgtgctcctccggtaccagctggcgccggttcccggtcaccgggtggaacaaaaaatg
tctcttactctttttatgaagaatgggcttcgggtttatttgcatcctcgccggctcggc
tag

DBGET integrated database retrieval system