KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111790412Help
Entry
111790412         CDS       T05351                                 

Definition
(RefSeq) arginine biosynthesis bifunctional protein ArgJ, chloroplastic
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00220  Arginine biosynthesis
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
cpep01210  2-Oxocarboxylic acid metabolism
cpep01230  Biosynthesis of amino acids
Module
cpep_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111790412
Enzymes [BR:cpep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     111790412
    2.3.1.35  glutamate N-acetyltransferase
     111790412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-GeneID: 111790412
NCBI-ProteinID: XP_023527065
LinkDB All DBs
Position
LG03
AA seq 460 aa AA seqDB search
MYLSVPPYPSLKLPALQSPKRNFRVFSVSTSETANYLPEAPILIPDGPWKQIGGGVTAAK
GFKAAGLYGGLRALGEKPDLALVTCDVDAISAGAFTKNVVAAAPVLYCKKALNDLETARA
VLINAGQANAATGDAGYEDVIECVNNLSKILQIRPEEVLVESTGVIGHRIKKDALLNSLP
KLVRSLSSSVEGAASAAVAITTTDLVSKSVAIESQVGGSTIRIGGMAKGSGMIHPNMATM
LGVVTTDAVVASDVWRKMVQISVDRSFNQITVDGDTSTNDTVIALSSGLSGSRSNIISSL
KSREAGQLQECLDVVMQGLAKSIAWDGEGATCLIEVAVNGASSEAEAAKIARSVAGSSLV
KSAIYGRDPNWGRIAAAAGYAGVAFEQKKLKVSLGNILLMDGGEPQCFDRAAASNYLRSA
GETHGTVKISISIGDGHGEGRAWGCDLSYDYVKINAEYTT
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtatctctccgttcctccctacccctctctcaaactccccgcccttcaatccccaaag
aggaattttcgagtgttttctgtgtctacgagtgagaccgccaattatttgccggaggct
ccgattttgattcctgatggaccatggaagcagattggtggaggagttaccgctgcgaag
gggttcaaagctgcggggctctatggcgggttacgtgcattgggagagaaacccgacctt
gcactcgttacttgcgatgttgatgccatttctgccggagcatttacaaagaatgtagtt
gctgcagcaccagtgttatactgtaaaaaagcattgaacgatttggaaacggcacgtgca
gtgttaataaatgctggtcaagccaatgccgccactggggatgctggttatgaagatgtg
atagaatgtgtcaacaatctttccaagatccttcaaataaggccagaggaagttctagtt
gaatctacaggggtgattggtcatagaatcaaaaaggatgcacttttgaattctcttcca
aaactagtcagatccctttcatcttcagttgaaggtgcagcttctgcagcagtggcgata
acgacgactgatcttgttagtaaaagtgtggcaatcgagtcccaagttgggggctcaacc
ataagaattggaggaatggcgaaaggttcaggaatgattcacccgaatatggctactatg
ctcggtgttgtaacaacggatgctgtggttgctagtgatgtttggagaaagatggtgcaa
atttctgttgatcgaagcttcaatcaaattacggtggatggggatacaagtaccaacgac
acagtcattgctttgtcgagtggcttgtcggggtctcgttctaatataatttcgtcactg
aaaagtcgagaagcaggacagcttcaagaatgccttgatgtggtgatgcaaggccttgcc
aagtcaatagcctgggatggtgaaggagcaacctgtctgattgaggttgcagtgaatggt
gcaagttcagaagccgaagcagcaaaaattgcccgttcggtggcaggctcgtcgcttgta
aagtcagctatatatggccgagatccaaactggggacgcatagcagcagctgccgggtac
gcaggggtggcgttcgagcagaagaaactcaaagtgtctctaggaaacattctcctaatg
gacggaggagaacctcaatgttttgacagggctgcagctagtaactatctcagaagcgct
ggagaaacccatggtactgtcaaaatttccatttctataggtgatgggcacggagaagga
cgggcatggggttgcgacttgagttacgactatgtcaagataaatgcagagtatactaca
tag

DBGET integrated database retrieval system