KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111790843Help
Entry
111790843         CDS       T05351                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00250  Alanine, aspartate and glutamate metabolism
cpep00410  beta-Alanine metabolism
cpep00430  Taurine and hypotaurine metabolism
cpep00650  Butanoate metabolism
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111790843
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111790843
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111790843
   00430 Taurine and hypotaurine metabolism
    111790843
Enzymes [BR:cpep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     111790843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 111790843
NCBI-ProteinID: XP_023527708
LinkDB All DBs
Position
LG01
AA seq 492 aa AA seqDB search
MVLSKTASQSDVSVHSTFASRYVRTSLPRFKMSENSIPKEAAFQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGENETAVG
VGTVGSSEAIMLAGLAFKRKWQNRRKAEGKPYDNPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPEKAVDLVDENTICVAAILGSTLNGEFEDVKVLNDLLIEKNKETGWETP
IHVDAASGGFIAPFIYPDLEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYQNVMENCKENMIVLKEGLEK
TGRFNIVSKDEGVPLVAFSLKDSSRHTEFEVSEMLRRFGWIVPAYTMPPDAQHITVLRVV
IREDFSRTLAERLVKDIEKVMHELDILPSRADIREETNHVVVAKKSALETQREITTAWRK
FVMDKKKTNGVC
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggttctttccaagactgcttctcagtcggatgtctccgtccattccacgttcgcttcg
cgatatgtgcgaacctctctcccgagattcaaaatgtcggaaaattcaatccctaaggaa
gctgcgttccagatcatcaatgatgaactcatgctcgatggaaaccctaggctgaatctg
gcctccttcgttaccacttggatggagcctgagtgcgataaactcataatggccgccatt
aacaagaattacgtcgatatggatgaatatcctgtcactacagagctccagaatcgatgt
gtgaacatgatagctcacttgttcaatgccccattgggggagaatgagacggcggtggga
gttggaacagtgggatcgtcggaggccataatgttggctggcttggctttcaagagaaag
tggcagaacagaaggaaggctgaaggcaaaccctatgacaaccccaacattgtcaccgga
gctaatgtccaggtatgctgggagaaattcgcaaggtacttcgaggtagaactgaaggag
gtgaaattgagggaaggttactacgtgatggatccagagaaagctgtggatttggttgat
gagaacaccatctgtgtagcagccatcttgggctccactctcaatggagaattcgaagac
gtgaaggtcttaaacgatctcttaatcgagaagaacaaggaaaccggatgggagactcct
attcatgttgatgctgcgagtggagggttcattgccccattcatataccctgatctagaa
tgggactttaggctgccccttgtaaagagtattaatgtgagtggccataagtatgggctt
gtttatgctggaattggttgggttatctggaggaacaaggaagacttgcctgaagaactc
atcttccatatcaactatcttggcgccgaccaacccactttcactctcaatttctccaaa
ggttctagccaagtcattgctcagtattaccaattgatccgcttgggttatgagggatac
caaaacgtgatggagaactgcaaagaaaacatgattgttctgaaggaaggactggaaaaa
acagggcggttcaacattgtgtctaaggacgaaggagttccactagtggcattctccttg
aaagacagcagtcgtcacacagagtttgaagtctcagaaatgcttaggaggttcgggtgg
atcgtgccagcttacacgatgcctccggacgcgcaacacattacagttctgagagtggtg
atccgagaagatttctcacgcacacttgctgagcgtctagtgaaagacattgaaaaggtg
atgcacgagctggacatcctcccgtcaagggctgatatcagagaagagacaaaccacgtc
gtggtggcgaagaagagtgcactggagacacagagggagatcaccactgcttggaggaag
tttgtgatggataagaagaagactaatggagtctgttaa

DBGET integrated database retrieval system