KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111790983Help
Entry
111790983         CDS       T05351                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH9-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111790983
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cpep03036]
    111790983
Enzymes [BR:cpep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111790983
Chromosome and associated proteins [BR:cpep03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111790983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 111790983
NCBI-ProteinID: XP_023527901
LinkDB All DBs
Position
LG03
AA seq 691 aa AA seqDB search
MDSPIPFQDLNLLPDPSAAVIPAATSPKTHTINSSVNKIVERGELLTPKLEPKLEPFDDL
FESRETQQPHQVQQTFLSSPSSNFFSNSDFAPTPLSDQNLTPLSQSSSISSDKDNVYSEF
YRISQLFRSAFGKGIQSYGDAGVVDPDARAIVPVSEENQISTVVVSKRRYDKRSSELVRV
TDLGVEDQRYFRDVVRRTRMIFDSLRVLSTSEEEKSSGLIRRLRSDLRASSLMRERGLWL
NRDKRIVGSIPGVHIGDLFFFRMELCVVGLHGQAQAGIDYVPASQSSNGEPIATSIIVSG
GYEDDEDAGDMIIYTGHGGQDKFSKQCMHQKLEGGNLALERSMHYGIEVRVIRGIKYSGI
VTSKIYVYDGLYRILDCWFDVGKSGFGVYKFKLLRIDGQAEMGSSIVKFAENLRTRPLSL
RPSGYLSLDISLKKEAVPVLLFNDIDNDQEPLYYEYLVRTVFPPFAFHQSGSGTGCNCVS
GCVHDCFCAMKNGGEFGYDQNGFLVRGKPIIFECGPFCQCPPQCRNRVSQKGLRHRLEVF
RSRETGWGVRSLDLIHAGSFICEYAGVVLTREQAQVLSMNGDTLIYPNRFSDRWAEWGDL
SQIYSNYMRPSYPSVPPLDFAMDVSRMRNVACYISHSTSPNVLVQFVLYDHNNLMFPHLM
LFAMENIPPLRELSIDYGVADEWSGKLAICN
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggattctcctatcccatttcaagacctcaatcttcttcccgacccatccgctgctgta
atacccgccgcaacatcccccaaaacacacacaatcaactcttctgttaacaaaattgtt
gaacgcggcgagctgctgacccccaagcttgaacctaagctcgagcccttcgacgatctt
ttcgagtcccgggagacccaacagccccatcaagttcagcaaaccttcttgtccagccct
tcctctaacttcttctctaactctgacttcgctcctacccccttgtccgaccagaatctt
acccctctttctcagtcttcatccatttcctctgataaggacaatgtttactccgaattt
taccgcatttctcagctgtttaggtctgcttttggtaaaggaattcagagctatggcgat
gcaggagttgtggatcctgatgctcgggcaattgtcccagtttcggaggagaatcagatt
tctactgtggtggtctctaagaggaggtatgataaaaggtcctctgaactcgttagagtc
actgatcttggggttgaggaccagaggtacttccgagacgtggtgagacggaccaggatg
attttcgattcgttgcgtgtgttatcaacgtcggaggaggagaagagttcgggactaatc
cggcgacttcggagtgatttgagggcttcgtccttgatgagagagcgtggtctgtggttg
aatcgagacaaacggattgttggttcgattccgggggtgcacattggcgatctattcttc
tttaggatggagttgtgtgttgttggattgcatggtcaggctcaagctggaattgactat
gttcctgcgagtcagagctccaatggcgagccaattgccactagcataattgtttctggg
ggttatgaggacgatgaagatgcgggggacatgataatctacacgggtcatggtgggcaa
gacaaattttcaaaacaatgtatgcaccagaaactcgaaggtgggaatcttgcactggag
agaagcatgcactacgggattgaagtgagggttattcgaggtatcaagtactcgggcatt
gtaacaagtaagatttatgtatacgatggtctgtatagaattcttgattgttggtttgat
gtggggaagtcgggttttggtgtctataagtttaagctgttgagaattgatggtcaagcc
gaaatgggtagctccattgtcaagtttgcggagaatctcaggactagaccattgtctttg
agaccttctggttatctcagtctggacatttcactgaagaaggaggcagttccagttctc
ctgttcaatgatattgacaacgatcaagaaccattgtattatgagtatcttgttagaact
gtgtttccacctttcgcctttcaccagtcaggaagtggcactgggtgtaattgtgtttca
ggttgtgttcacgattgcttttgtgctatgaaaaatggtggggagtttggttatgatcag
aatggatttctagtgagaggaaagcctataatttttgaatgcggaccattctgtcaatgc
ccccctcaatgtcggaatcgtgtttcacagaagggcttgaggcaccgactcgaggttttt
aggtccagggaaacaggttggggagttagatctttggacttgatacatgctggttctttt
atatgtgaatatgcaggagttgtcctcacgagggaacaagctcaagttctttctatgaat
ggtgatacattgatatatccaaatcgtttttcggatagatgggcagaatggggtgatcta
tctcaaatatattctaattatatgcggccatcttacccttccgttcctcctctcgatttt
gcgatggatgtatccagaatgaggaatgttgcttgttatataagccatagtacatctcca
aacgtgttggtgcagttcgtattatatgatcataataacttaatgtttcctcatcttatg
ttgtttgcgatggaaaacatccctcctctgagagagcttagcattgattacggtgtggct
gatgaatggtcagggaaacttgctatctgtaactaa

DBGET integrated database retrieval system