KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111794089Help
Entry
111794089         CDS       T05351                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpep01001]
    111794089
Enzymes [BR:cpep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111794089
Protein kinases [BR:cpep01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   111794089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Pkinase_C Kdo APH RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 111794089
NCBI-ProteinID: XP_023531988
LinkDB All DBs
Position
LG04
AA seq 483 aa AA seqDB search
MVYASTPNKNMHALLTAKLTKLTLPSSSSSSSPPPPPPPSSSTAALLDFDFSDVFGPTNS
SLPSFPGDPQHNEQQPAVIHNRSHSFVGPSPRLTPPSSLSFFREVKSQIEEEEDDLEIST
GDGVQKEKGADESENDGGENSEGKVGVGDFDILRVVGKGAFGKVFLVRKKGDSKGNGPNN
DGIYAMKVMRKDTIIKKNHVDYMKAERDILTKVSHPFIVQLRYSFQSKSKLYLILDFING
GHLFFHLYRQGIFSEDQARVYAAEIVSAVSHLHDSGIVHRDLKPENILMDADGHVVLTDF
GLAKEIDESSRSNSLCGTTEYMAPEILLSKGHNKDADWWSVGVLLYEMLSGKPPFTHANR
KKLQERIIKEKVKLPPYLSTEAHSLLRGLLQKDPSKRLGSGPNRGADIKNHKWFRPVNWK
KLECRELQPKFKPDVKGNDCTANFDNCWTTMPPDDSPAPTPTDGGHFHGYSYVAPDPWLS
SSG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggtgtatgcatctactcctaacaagaacatgcacgcccttctaacagccaaactcacc
aaattgactctcccttcctcttcttcttcttcttctcctcctcctcctcctcctccttct
tcatccacggccgcccttcttgacttcgacttctctgacgtattcggccccacgaattcc
tctttaccatctttccccggggacccacagcacaatgaacaacaaccagcggtcattcat
aacagatctcactcgtttgtgggtccgtctccacggttaactcccccttcttccctttct
tttttccgagaagttaaatcacagatcgaggaggaagaagatgaccttgaaatctcaact
ggcgatggagttcagaaggagaagggggcggatgagagcgagaatgacggtggagaaaat
tcagaggggaaggttggagttggggatttcgatattcttcgagttgtgggaaaaggggcg
tttgggaaggtctttctagtgaggaagaaaggggattcgaaaggaaacggtcccaataat
gatgggatttacgccatgaaagtgatgagaaaggataccattataaagaagaatcatgtg
gattatatgaaggctgagagagatattctcacaaaagtttcgcaccctttcattgttcaa
ctccgctactctttccagtccaaatcaaaactctatttgattcttgatttcataaatggg
gggcatctgttcttccatctgtaccggcaggggatctttagtgaggatcaggcaagggtc
tatgctgctgagatcgtgtcagctgtttcgcatcttcatgacagcggcattgtgcaccgg
gatctcaagcctgagaacattcttatggatgctgatggccatgttgtccttacggatttt
ggactggcaaaggaaattgatgaatcgagtcggtcgaattcgttgtgtggaacaacagaa
tacatggctccggaaatcttgctttctaaaggtcacaacaaggatgctgattggtggagt
gtcggagttcttttgtatgagatgcttagtggcaagccaccattcacacacgcaaataga
aagaagcttcaagagagaataatcaaagagaaagtgaaacttccaccatacctgagcact
gaagctcactctttgctcagagggctattgcaaaaggatccttctaaaagattaggaagt
ggacccaacagaggggcggacataaaaaatcacaaatggtttcgacctgtgaactggaag
aaattggaatgtagggagctgcaaccaaaattcaagccggatgtcaagggaaatgactgc
acggcaaattttgataattgttggacgacgatgccccccgacgactcgccagctccaacg
ccaaccgatggaggacacttccacggatactcgtatgttgctccagacccttggctttca
tcatctggatag

DBGET integrated database retrieval system