KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111794107Help
Entry
111794107         CDS       T05351                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00010  Glycolysis / Gluconeogenesis
cpep00053  Ascorbate and aldarate metabolism
cpep00071  Fatty acid degradation
cpep00280  Valine, leucine and isoleucine degradation
cpep00310  Lysine degradation
cpep00330  Arginine and proline metabolism
cpep00340  Histidine metabolism
cpep00380  Tryptophan metabolism
cpep00410  beta-Alanine metabolism
cpep00561  Glycerolipid metabolism
cpep00620  Pyruvate metabolism
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111794107
   00053 Ascorbate and aldarate metabolism
    111794107
   00620 Pyruvate metabolism
    111794107
  Lipid metabolism
   00071 Fatty acid degradation
    111794107
   00561 Glycerolipid metabolism
    111794107
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111794107
   00310 Lysine degradation
    111794107
   00330 Arginine and proline metabolism
    111794107
   00340 Histidine metabolism
    111794107
   00380 Tryptophan metabolism
    111794107
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111794107
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    111794107
Enzymes [BR:cpep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111794107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25 DUF1487
Motif
Other DBs
NCBI-GeneID: 111794107
NCBI-ProteinID: XP_023532015
LinkDB All DBs
Position
LG04
AA seq 552 aa AA seqDB search
MAARRGICSLLSRSLLSSSCSSSSSCSSGYGFGSFLQSRGRVSRLHGIGRRFSSSALAEE
ELVTPPVQISYTQNLINGQFVDAASGKTFPTYDPRTGEVIAHVAEGEAEDINRAVSAARK
AFDEGKWPKMTAYERSRILLRFADLVEKHSAELAALETWNNGKPYEQSARTEIPIFVRLF
HYYAGWADKIHGLTVPADGKYHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTI
VLKTAEQTPLTALYVAKLFHEAGLPPGVLNVVSGYGPTAGAALASHMDVDKLAFTGSTNT
GKVVLELASKSNLKPVTLELGGKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTF
VHERIYDEFVEKSRARAQRRVVGDPFKKGVEQGPQIDSEQFAKVLRYIKSGIESDATLEC
GGDRLGSKGYFVQPTVFSNVKDDMLIAKDEIFGPVQSILKFKDIDEVIQRANATRYGLAA
GVFTTNLDTANTITRGLRTGTVWVNCFDVFDAAIPFGGYKMSGMGREKGIYSLQNYLQVK
AVVTPLKNPAWL
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcggagaggaatctgttctttactatctcgttctctgttatcatcttcttgt
tcttcttcttcttcttgttcttctggttatgggtttggttcttttctccaatctcgtggg
agagtttcaaggttgcatggaatagggagaagattcagctcatctgctttggcggaggag
gaacttgttactcctcctgttcagataagttacactcagaatctgattaatgggcagttt
gtggatgctgcatcagggaaaacgtttccgacctacgatcctcgcaccggggaagtgatt
gctcatgttgccgagggcgaggcggaggatatcaaccgggcagtatcggcagctcgcaag
gctttcgacgaggggaaatggccgaaaatgactgcttatgaacgatcgaggatattactg
cggttcgctgatttggttgagaagcatagcgctgagcttgcagcattggagacatggaac
aatggcaaaccttatgaacaatcggctcggaccgaaatacctatattcgtgcgcttgttt
cactattacgccgggtgggcggacaaaatccatggcttgaccgttccagctgatgggaaa
tatcatgtgcaagtattacatgaaccaattggagttgcaggacagataattccatggaac
tttcctctccttatgtttgcttggaaagttggtcctgctctagcctgtggcaacaccatt
gtcctaaaaactgcagagcaaacgcctctgaccgctctttatgtcgcgaagttattccac
gaggctggtcttcctccaggagttctgaatgtcgtttcgggctatggtccaaccgcgggt
gctgcccttgctagccatatggatgtggacaagctagcctttacaggatcgacgaacacg
ggaaaagttgtgctcgaattggcatctaaaagcaatttgaaaccggtaacgctcgaactt
ggagggaaatcgcctttcatcgtttgtgaggatgcagatgttgataaggccgtagagctt
gctcattttgctctttttttcaatcaggggcaatgttgctgtgctggatctcgtactttc
gtgcatgagcgtatatacgacgagtttgtcgagaagtcgagggcacgtgcccaaagacgt
gtggttggtgatcctttcaagaagggtgttgaacaaggtcctcagatcgactcggagcag
tttgcaaaagtcctaagatacataaaatctggcattgaaagtgatgctactttggaatgt
gggggtgacagacttgggtccaagggatacttcgtccagccgacagttttctcaaatgtt
aaggacgatatgttgatagcgaaggacgaaatctttggcccagtacaatccatcttgaaa
ttcaaggacattgacgaagttattcaaagggcaaacgcaactcgttacggtctagctgct
ggagttttcactacaaacctcgacacagccaacaccataacacgaggattgagaacaggg
acggtgtgggtgaattgcttcgacgtatttgacgctgcaataccgtttggtgggtataag
atgagcggaatggggagggagaaaggaatttacagcctccaaaactacttgcaggtgaag
gctgtagttactcctctgaagaatccagcatggttatga

DBGET integrated database retrieval system