KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111796737Help
Entry
111796737         CDS       T05351                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00620  Pyruvate metabolism
cpep00710  Carbon fixation in photosynthetic organisms
cpep01100  Metabolic pathways
cpep01200  Carbon metabolism
Module
cpep_M00168  CAM (Crassulacean acid metabolism), dark
cpep_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
cpep_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cpep_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111796737
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111796737
Enzymes [BR:cpep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     111796737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 E2R135
Motif
Other DBs
NCBI-GeneID: 111796737
NCBI-ProteinID: XP_023535247
LinkDB All DBs
Position
LG06
AA seq 965 aa AA seqDB search
MPNRNVEKMASIDAQLRLLAPARVSDDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC
YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGVFADENSATTESDIEETLKKLVGKLNKSPQEVFDALKNQTIDLVLTAHPTQSVRRS
LLQKHARIRDCLVQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCSSELRERADVLHNSSRRDAKHYIEFWKQVP
ANEPYRVILGDVRDKLYQTRERSRHLLANGYSDIPEDATFTNVEQFLEPLELCYRSLCAC
GDRPIADGTLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLEAITQHLDIGSYKEWSEKQR
QEWLLSELSGKRPLFGPDLPTTEEISDVLNTFHVIAELPSDNFGAYIISMATAPSDVLAV
ELLQRECHVTQPLRVVPLFEKLADLEAAPAALARLFSIDWYKDRINGKQEVMIGYSDSGK
DAGRFSAAWQLYKAQEELIRVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRTLMDEMAVVATE
EYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHIIQKDVKNLQMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSEDLWPFGQRLRANYEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYITTLNACQA
YTLKRIRDPNYHVTVRPHISREIMEASKPADELVKLNPKSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaccggaatgtcgagaagatggcatcgattgatgcgcagcttcggcttctagca
ccagctagagtgagtgatgatgataaattggtggagtatgatgcgttgttgctggatcgg
ttccttgatattcttcaggatttgcacggggaggatctgaaggaaactgtgcaagagtgt
tatgaactttctgctgaatatgaagggaaacacgatccgaagaaacttgaggagctcgga
aatgtgctgactagtttagatccaggggactctattgtcattgccaaatctttttcccat
atgcttaatttggctaacttggccgaggaggttcagattgcttatcgtcgaaggatcaaa
ctgaagaagggagtttttgctgatgagaactctgcaaccactgaatccgacattgaagaa
actctgaagaagcttgtggggaaactgaataagtcccctcaagaagttttcgatgccttg
aagaaccagactatagatttggtcttaactgctcatccgactcaatcagttcgtagatct
ttgcttcagaagcatgcaaggatacgggactgtttagttcagttgtacgccaaagacatt
actcccgatgacaagcaagaacttgatgaggcacttcagagagagattcaagctgcattt
cgtactgatgaaatccgtagaactcctcctaccccacaagatgaaatgagggcaggaatg
agctacttccacgagacaatttggaagggtgttcctaaatttctgcgccgtgttgatact
gctttaaaaaacatagggatcgatgaacgtgttccttataatgcaccactaattcagttt
tcatcttggatgggtggtgaccgtgatggtaatcccagggtgacaccggaggtaacaagg
gacgtctgtcttcttgctagaatgatggctgctaatctgtactactcacagattgaggat
ctcatgtttgagttgtctatgtggcgttgcagtagtgagcttcgtgagcgtgcagacgtg
cttcataattcatcaaggagagatgcaaaacactatatagaattttggaagcaagttcct
gccaatgaaccctaccgagtgattcttggtgacgtaagggacaagctttatcagacgcgt
gagcgttctcgccatttgttagctaatggatattcggacatcccagaggatgcaactttt
acaaatgttgagcagttcttggaacctcttgaactatgctacagatccctctgtgcttgt
ggtgaccgaccgattgctgatggcacccttcttgattttttgaggcaagtgtccactttt
ggcttgtcacttgtaagacttgacatcaggcaggagtcggatcgtcacactgacgttttg
gaagccattactcagcatttggatattggttcctacaaagaatggtccgagaaacagcga
caagaatggcttctatcggaacttagtggcaaacgtcctctttttggtcctgatcttcct
acaactgaagaaatatctgatgttttgaacacgttccatgtcatagcggaacttccttct
gataacttcggtgcatatatcatttccatggccactgctccgtctgatgttttagcagtt
gagctattgcagcgtgagtgccatgttacgcaaccgttgagagttgttcccctgttcgag
aagcttgcagatttggaggctgcaccagcagcccttgctcgcctcttctcgatagattgg
tacaaagaccggattaacggaaagcaagaagtcatgattggctactcggattctggtaaa
gatgctggacggttctctgcagcctggcagttgtacaaggctcaagaggagcttataagg
gttgcaaagcaatatggtgtgaagctaactatgtttcacggtcggggtggcaccgttgga
agaggaggtggacctactcatcttgctattttgtcccaaccacccgagacaattcatggt
tcgctccgtgtaacggtacagggggaagttattgagcagtcctttggagaggagcacttg
tgttttcgaacactccaacgtttcactgctgcaacgcttgagcacggaatgcaccctcca
gtttcaccaaaacctgaatggcgtacactgatggacgaaatggctgttgttgcaacagaa
gaataccgttcaatcgtcttccaagagccacgatttgtcgaatatttccgccttgcaaca
cctgagctcgagtatggtaggatgaatattggaagccgtccatccaaacgaaagccaagc
ggcggtatcgagtcacttcgtgcaatcccatggatctttgcatggacacagacgcgattt
catcttccagtttggttaggctttggagcagcattcaagcatattattcagaaagatgtt
aagaaccttcaaatgttgcaggagatgtacaacgaatggcccttctttagggtcaccatt
gatttggtcgaaatggtgttcgctaaaggagaccctggcatcgcagcgttgtacgacaag
ctcctagtttcggaggacctctggccatttggacagcgcttgagagccaactatgaagaa
acaaagagccttctactgcagattgctggacacaaagatcttcttgaaggggatccttac
ttgaagcaaagacttcgtctccgtgattcatacatcacgactctgaacgcttgccaagca
tacacactgaaacgaatccgtgatccgaactaccacgtgacagtgcgtccacacatttca
agggaaataatggaagcaagcaaaccagcagacgaactggtgaagctaaacccgaagagc
gagtacgcacctgggctagaggacactctgatcttgaccatgaagggtattgctgctgga
atgcagaacactggttaa

DBGET integrated database retrieval system