KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111798692Help
Entry
111798692         CDS       T05351                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00010  Glycolysis / Gluconeogenesis
cpep00053  Ascorbate and aldarate metabolism
cpep00071  Fatty acid degradation
cpep00280  Valine, leucine and isoleucine degradation
cpep00310  Lysine degradation
cpep00330  Arginine and proline metabolism
cpep00340  Histidine metabolism
cpep00380  Tryptophan metabolism
cpep00410  beta-Alanine metabolism
cpep00561  Glycerolipid metabolism
cpep00620  Pyruvate metabolism
cpep00903  Limonene and pinene degradation
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111798692
   00053 Ascorbate and aldarate metabolism
    111798692
   00620 Pyruvate metabolism
    111798692
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111798692
   00561 Glycerolipid metabolism
    111798692
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111798692
   00310 Lysine degradation
    111798692
   00330 Arginine and proline metabolism
    111798692
   00340 Histidine metabolism
    111798692
   00380 Tryptophan metabolism
    111798692
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111798692
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    111798692
Enzymes [BR:cpep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111798692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 111798692
NCBI-ProteinID: XP_023537762
LinkDB All DBs
Position
LG07
AA seq 535 aa AA seqDB search
MAARRISSLLSRSLASSPALLSKGRRPSGGRTTGKYSTSAAVEDPITPSVKVNYTQLLIN
GQFVDSVSGKTFPTLDPRTGEVIANVAEGDARDIDLAVSAARKAFDDGPWPRMTAYERSK
ILLRFADLVEKHADEVAALETWDNGKTYEQSAKLEVPMFVRLFRYYAGWADKIHGLTVPA
DGSYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLSAIYVAK
LLHEAGLPAGVLNIVSGYGPTAGAALASHMEVDKLAFTGSTETGQIVLELAAKSNLKPVT
LELGGKSPFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKSRKRA
ANRVVGDPFLGGIEQGPQVDGEQFKKILKYIKSGIEGGATLEAGGERFGSKGYYVQPTVF
SNVKDDMTIAQEEIFGPVQTILKYKEVEEVIRRANASRYGLAAGVFTQNIDTANRLTRAL
RVGSVWINCFDIFDAAIPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLNNPTWL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcggaggatatcctcgctcttatctcgttcccttgcttcttcacctgctctc
ctttccaaagggaggaggccttccggtggcagaacaactggcaaatatagcacctccgct
gctgttgaggatccaattactccatctgtgaaagtaaattacacccagctgctaatcaac
ggacagtttgtggattcagtttcaggaaaaacttttcctacactggacccaaggactgga
gaagtcattgcgaatgttgctgaaggtgacgccagagatattgatcttgcagtttctgct
gcacgcaaggcattcgatgatgggccttggcctagaatgactgcttatgaaaggtcaaag
atacttttgcgatttgccgatttggttgaaaagcatgccgatgaagttgcagcactcgaa
acttgggacaatgggaaaacatacgaacagtcagccaaattggaagtcccaatgtttgta
cgcctcttccgatattatgcggggtgggccgataagattcacggactcacagttccagct
gatggctcgtatcatgtgcagaccttgcacgaaccaattggtgttgcgggtcagattatt
ccatggaactttcctctgctcatgtttgcttggaaggttggtccagcattagcatgtggg
aatactattgttctgaagacagccgagcagacacctttgtctgctatctatgtggctaag
ctattgcatgaggctggacttcctgcgggcgttctcaatattgtttccggttatggaccc
actgctggtgctgctcttgccagtcatatggaagttgacaagcttgcttttactggatca
accgaaacagggcagattgtacttgaactagctgcaaaaagcaatctgaagccagtaact
ttggagcttggtggaaaatcccctttcattgtatgtgaggatgctgatgtggataaggct
gtcgagatggcacactttgctctcttcttcaaccagggacaatgctgctgtgctggttcc
cgtacttttgttcatgaaaaagtgtatgatgagtttctagaaaaatcaaggaaacgagct
gcaaaccgcgttgttggtgatccattcctaggtggaattgagcaaggtcctcaggtggac
ggcgaacaattcaaaaagattttgaaatatataaaatctgggattgaaggtggagccact
ctcgaagctggaggagagaggtttggttccaagggttactatgtccagccaacagttttc
tcgaacgtcaaggatgacatgacaattgcacaggaggagatttttggtcctgtacagaca
atcttgaaatacaaagaggttgaggaggtgataaggagggcaaatgctagtcgctatggg
ctggcggctggggtgtttactcaaaatatcgacacagccaacaggctgacgcgtgcgctg
agagttgggtctgtgtggatcaattgcttcgatatatttgatgctgcgattccttttggt
gggtacaagatgagcggacatggacgagaaaagggtatttacagcctcagcaattatctg
caagtgaaggctgttgtcactcctttgaacaaccctacttggctctaa

DBGET integrated database retrieval system