KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111799980Help
Entry
111799980         CDS       T05351                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00010  Glycolysis / Gluconeogenesis
cpep00020  Citrate cycle (TCA cycle)
cpep00620  Pyruvate metabolism
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
cpep01200  Carbon metabolism
Module
cpep_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111799980
   00020 Citrate cycle (TCA cycle)
    111799980
   00620 Pyruvate metabolism
    111799980
Enzymes [BR:cpep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     111799980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding SOG2
Motif
Other DBs
NCBI-GeneID: 111799980
NCBI-ProteinID: XP_023539308
LinkDB All DBs
Position
LG01
AA seq 492 aa AA seqDB search
MASSFLSRAALSSNTTAISFSFSSSISSPLPWSSSRSYTSFPANSRRRIPVIQSKIREIF
MPALSSTMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGET
APVGAPIGLLAETEEEVAEAKAKAASKSASAPLTPAAAVSPSPPPPSSSPAPAISQPSPP
PPMAASDGPRKTVATPQAKKLAKQHKVDIGSITGTGPFGRITPADVEAAAGIAPSKPAVS
NVASETASVAAAAPTKATAAPSNLPPPVPGSTVVPFTTMQAAVSKNMVESLSVPTFRVGY
PVSTDALDALYEKVKPKGVTMTALLAKAAAMALAQHPVVNASCKDGKSFTYNSNINIAVA
VAINGGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPNEYNSGTFTLSNLGMFGVD
RFDAILPPGQGAIMAVGASKPTVVTDADGFFSVKSKMLVNVTADHRIVYGADLAAFLQTF
AKIVENPESLTL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcgttcctctctcgagctgctctctccagcaataccaccgccatttcattt
tccttctcttcttccatctcttctcccctcccatggagctcttcccgttcatacacctcc
tttcccgctaattctcgtcggaggattcccgtcattcaatccaagatccgcgagattttc
atgcctgccctaagctccaccatgactgagggaaagattgtttcgtgggtcaaatctgaa
ggggacgttctatccaaaggagagagtgtcgtcgttgtggagtctgacaaggcggatatg
gatgtggagactttttatgatggaattctcgctgctattgttgttggagagggtgaaact
gcccctgttggagctccgattggtttattggccgagactgaagaggaggtcgcggaggct
aaggctaaagccgcgtcaaaatctgcgtctgctcctttgactcctgctgctgctgtttct
ccctctcctccgcctccctcttctagtcctgctccggcgatatctcagccatcgcctccg
ccgccaatggctgcgtcggatggaccaaggaagactgtggctacccctcaggcgaagaag
ctagccaaacagcacaaggtggatattggatcgataacaggcactggtccatttggtcga
attacgccggcggatgtggaggccgcagcaggaattgccccttccaagcctgctgtaagc
aatgtggcttctgagactgcttcagtggctgccgctgctccaacgaaagccactgcagct
ccttccaacttgcctcctccagttccgggctcaacggttgtgccattcacgacaatgcag
gcggcggtgtctaagaatatggtggagagtctctctgttcctacattccgagttggttat
ccggtatccactgatgctcttgatgcgctctatgagaaggtgaaaccaaagggtgtcaca
atgactgccctcctggccaaggctgctgcaatggccctcgctcagcatcctgttgtgaat
gcaagctgtaaagacggtaagagctttacgtataacagcaacataaatattgcagtagcc
gtggctatcaacggtgggttgataactcctgttcttcaggatgcagataagttggacctc
tacctactgtctcaaaaatggaaagaattggtagagaaagccagatccaagcagcttcag
cccaatgagtataattcaggaacttttactctttccaatctgggcatgtttggagtggac
aggttcgatgctatacttcctcctggccagggagctatcatggccgttggagcatcaaag
ccgaccgttgtcactgatgctgatggctttttcagcgtgaaaagtaaaatgctggtgaat
gtgaccgctgatcaccgaatagtttatggtgctgacttggctgccttccttcagaccttc
gcaaagatagttgagaatccagaaagcctgaccttgtag

DBGET integrated database retrieval system