KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111801005Help
Entry
111801005         CDS       T05351                                 

Definition
(RefSeq) transcription factor bHLH140
  KO
K10863  aprataxin [EC:3.1.11.7 3.1.11.8 3.1.12.2]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cpep03400]
    111801005
Enzymes [BR:cpep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.7  adenosine-5'-diphospho-5'-[DNA] diphosphatase
     111801005
    3.1.11.8  guanosine-5'-diphospho-5'-[DNA] diphosphatase
     111801005
   3.1.12  Exodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.12.2  DNA-3'-diphospho-5'-guanosine diphosphatase
     111801005
DNA repair and recombination proteins [BR:cpep03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     111801005
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     111801005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DcpS_C AAA_33 HIT Macro zf-C2HE AAA_18 Zeta_toxin CPT AAA Melibiase ABC_tran AAA_16 AAA_17 AAA_22
Motif
Other DBs
NCBI-GeneID: 111801005
NCBI-ProteinID: XP_023540723
LinkDB All DBs
Position
LG08
AA seq 742 aa AA seqDB search
MDMDIDENSTAKGNERRTKLIMVILVGAPGSGKSTFCELVMASSSRPWVRICQDTIGNGK
SGTKAQCLKSAASALNDGKSVFVDRCNLEIEQRSEFVKLGSSLVDVHAVVLDLPAQLCIS
RSVKRTGHEGNLSGGKAAAVVNKMLQKKELPNLNEGFKRITFCHSETEVQSAIDTYKSLG
LHDALPDGCFGQKNADKKVQLGIMRFLKKAENPAKTCSNANTNKDFPSSQTTQEKKESSC
TMLSNVNKESEKGEKPGVRSLENNISESDSPTLAFPSISTSDFKFSHEKAAEIIVEMVEE
FMDKLGNARLVMVDLSHGSKILSLVKAKAAKKNICSTKFFTFVGDITKLKSDGGLHCNVI
ANAANWRLKPGGGGVNAAIFSAAGPSLEEATKQQAKSLRPGNVVAVQLPSTSPLFNREGV
THVIHVLGPNMNPQRPNYLNNDYDEGCKLLRDAYSSLFQAFISIVKDEFKSAKGIDERLG
SAPSESRKHSEDTHHKFKRAELQIPERSKKWKGTQESAEALNQNNNKISHKMSKHWGSWA
QALYNTAMYPERHANTVLETSDDVVVLNDIYPKARKHLLIVARYEGLDQLADVHKEHLPL
LKTMHAVGMKWIDKFIHDDASLVFRLGYHSAPSMRQLHLHVISQDFDSSHLKNKKHWNSF
NTDFFRDSVDVIDEVSSHGKAIIKDDESLMSMEFRCNRCRSAHPNLPKLKTHISKCQSPF
PSTLLEGGRLVNASGNSRNSLS
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggacatggatatcgacgaaaattcgacagccaaaggaaatgaacggcgaacgaagctc
ataatggtgatattagtgggcgcacctggaagcggaaagtccaccttctgcgaactcgta
atggcctcctcttctcgcccttgggttcgaatctgccaggataccattggaaatggcaag
tccggaacgaaagcacagtgtttgaagagtgcagccagtgcattgaatgatggaaagagt
gtatttgtggacaggtgcaatcttgaaatagagcagcgttctgagtttgtgaaactaggt
agctctctagtggatgtacatgctgttgtattggatcttcctgcacagctctgtatctcc
cgttcggttaagcggaccggtcatgaagggaacctatcaggtggaaaagctgctgctgtt
gtgaataaaatgctgcaaaagaaagaattgccgaacctgaatgaagggttcaagcgtata
acgttttgtcacagtgaaacggaagttcaatccgctatagatacgtataaatcacttggt
ttacatgatgcacttccagatggatgttttggacagaagaatgcagacaagaaagtgcaa
ttaggcataatgaggttcttaaagaaagcagaaaatcctgctaaaacatgttctaatgcc
aataccaataaggattttccaagttctcaaactacccaggaaaagaaagagtcttcctgc
acgatgttgagcaatgtcaataaagagtcggagaaaggcgaaaaaccaggcgttagatcc
ttagaaaacaatatttctgaaagtgattccccaacacttgcatttccttctatttcaacg
tcggatttcaagttcagccatgaaaaggctgctgaaattattgttgagatggtggaggaa
ttcatggataagcttgggaatgccagacttgttatggtagacttgagtcatggatcaaag
attttgtctctagttaaagctaaagcggccaagaaaaatatttgttccaccaagtttttt
acatttgtaggtgatataactaaactcaagtcagatggtggattgcactgcaatgtaata
gccaatgctgcaaactggcgattgaaaccaggagggggtggtgtcaatgcagcaattttt
agtgctgcaggtcccagtctggaagaggcaacaaaacaacaagccaagtcccttcgacct
ggcaatgttgtggccgttcaattgccttcaacttctcctttgtttaatagggaaggggta
acccatgtcatacatgttcttggaccaaacatgaatcctcaaagaccaaattatctcaac
aatgattatgatgaaggttgcaagcttcttcgtgatgcttattcttctctatttcaagcc
tttatttcaatagtaaaagatgagtttaagtcggcgaagggaattgacgaacgcctcggc
tcagcaccttcagaatcacgaaaacactccgaggacacccatcacaagtttaagagagcg
gagttgcaaattcctgaaagaagcaaaaagtggaaaggaactcaggaatcagctgaagca
ttaaaccaaaacaacaataagatttcccataagatgagtaagcactggggctcatgggca
caagcactttacaacactgcaatgtatcccgagagacatgctaatactgtactggagaca
tcagatgatgttgtagtactgaatgatatttatccaaaagcacgcaaacatcttctgata
gtggctcgatatgaaggcctcgatcaactagctgatgtacataaagaacaccttccactg
ttgaagacgatgcacgccgtgggtatgaagtggattgataagttcattcatgacgatgca
tcattggtttttcgcctcggataccactcggctccatccatgaggcaactgcacctacat
gtcataagccaagattttgactccagtcatctgaagaacaagaagcattggaattctttc
aacactgatttcttccgagactcggtcgacgtcatagacgaagtcagtagccatggaaag
gcaatcatcaaggacgacgagagcttgatgtctatggagtttcgttgcaacagatgcaga
agtgcccatcccaacttacccaagctgaaaacacatatttccaaatgccaatcgcctttc
ccttccacgctactcgagggcggtcgtttagtgaatgcttcaggtaattctcgtaactct
ctttcgtag

DBGET integrated database retrieval system