KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111801977Help
Entry
111801977         CDS       T05351                                 

Definition
(RefSeq) beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00052  Galactose metabolism
cpep00511  Other glycan degradation
cpep00531  Glycosaminoglycan degradation
cpep00600  Sphingolipid metabolism
cpep00604  Glycosphingolipid biosynthesis - ganglio series
cpep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111801977
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    111801977
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    111801977
   00604 Glycosphingolipid biosynthesis - ganglio series
    111801977
   00511 Other glycan degradation
    111801977
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpep04147]
    111801977
Enzymes [BR:cpep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     111801977
Exosome [BR:cpep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111801977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 SfLAP
Motif
Other DBs
NCBI-GeneID: 111801977
NCBI-ProteinID: XP_023541998
LinkDB All DBs
Position
LG09
AA seq 719 aa AA seqDB search
MSYSSKLSAMAKRRPVRASLIFLLLILLTAFGVIVPVFALLPSLNSHSHRLFRHHQDHSE
LKKVQTRKFEIDDDMFWKDGKPFQIIGGDIHYFRTLPEYWEDRLLRAKALGLNTIQTYIP
WNLHEPQPGNFTFSGIADIVSFIQLCQKLDFLVLLRAGPYICAEWDLGGFPAWLLARKPA
PTLRSSDPGYLQWVERWWGIILPKVAPLLYNNGGPIIMVQIENEFGSYGDDQAYLHHLVK
LARGHLGNEVILYTTDGGTRETLEKGTIRGDAVFSAVDFSTGERPWPIFNLQKEFNAPGK
SPPLSAEFYTGWLTHWGENIATTDADSTAAALREILAGQGSAVLYMAHGGTNFGFYNGAN
TGDSALDYKPDLTSYDYDAPIKESGDIDNAKYDAIRRVIQRYSGALLPSAPSNIEKIGYG
PIHLQKSAFLFDLIHMIDPVDVFISEEPLSMESVDQSFGFLLYATKYVAKDNEDGHVLFI
PKVHDRAQVFLSCSSRNKGVRPASVGIIERWSNRRLNLPNTRCDSNILYILVENMGRINY
GRYLFDKKGILSSVYLDDNILYGWKMIPIPFNNLNEIPRVNSFSHIARSVHNKITAKRGL
EVKHDNISSEPTLYTGYFYVDKVNLRKDTFLSFAGWTKGIAFVNDFNLGRFWPVVGPQCS
LYVPAPILRLGKNVLVIVELESPNGEGVVHSVDRPDVSCGDSSYSNLSQLLTHQHSPRL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgagttacagttcgaaactttcagctatggcgaagagacgacctgtgagagcttctcta
atcttcctcctcctcatcttgcttacagcttttggagtgattgttccagtgtttgctctt
cttccttcactgaattcccactcccaccgtctcttccgccatcaccaagatcattccgag
ctcaagaaggttcaaactagaaagtttgagattgatgatgacatgttttggaaagatggt
aagccattccagattattggtggcgacatacattatttccgaactcttcctgagtactgg
gaagatagactgcttagagcaaaggcattgggcttaaacacgatccaaacttacatcccc
tggaatctgcatgagccacaaccgggaaatttcacgtttagtgggattgcagacatagtg
tcgtttatccaactctgtcagaagctagattttctagttttgctccgggcaggaccttat
atatgtgcagagtgggatttagggggttttcctgcttggttgcttgccagaaagccagct
cctacattaagatcctcagatcctggctacctccaatgggttgaaagatggtgggggatt
attcttccgaaggtagctccccttctttacaacaatggaggccctattataatggtccag
attgaaaatgaatttggctcatatggagatgatcaagcttaccttcaccatttggttaag
ttggcgagaggccaccttgggaatgaagtaatactgtatactacagatggcggtaccagg
gaaactcttgagaaaggaaccattcgtggggatgctgtcttttcagctgttgacttttct
actggtgaaaggccttggcctatttttaatttacagaaggagttcaacgcccctggaaaa
tctccacctctttctgcagagttctatactggctggcttacacattggggagaaaatatt
gcaacaactgatgccgactctacagcagctgcgttgagagaaattttggcagggcaaggg
tctgccgtgctttatatggctcatggtggaacaaattttggattttataatggagcaaat
acaggtgatagtgcgttggattacaagcctgatcttacttcttatgattatgatgcccca
attaaggaatcgggcgacattgacaatgctaaatatgatgcaattcgaagggttatacag
cgctatagtggagcattgcttccttcagctccttctaatattgaaaagataggttatgga
ccgattcacttgcagaaaagtgcatttttgtttgatctgatccatatgatagatcctgtt
gatgtgtttatatctgaagaaccactgtcaatggaatctgtggatcagagctttggattt
ttattatatgcgaccaaatatgtggccaaggacaatgaagatggacacgttttatttata
ccaaaggtgcatgatcgagcacaagtgttcctttcttgctcttctagaaacaagggtgtg
cggccagcttctgttggcattattgaaagatggtcaaaccggcgacttaacctgccaaat
acgagatgtgactcaaatatcttatatattttggttgaaaacatgggtcgcataaactat
ggacgctacttgtttgacaagaagggtatcttatcatccgtttatttggacgacaatatt
ttatatggatggaaaatgatcccaatccctttcaacaacctcaatgagattccgagagtc
aattctttctctcatattgctcgttctgtacacaacaaaatcacagcaaagagaggttta
gaagtcaagcatgataacatctcgagcgaaccaacactttacaccggttatttctacgtt
gacaaagtgaacctcagaaaagatacattcttatcatttgctggctggactaaagggatt
gcatttgtgaatgactttaatctcggaagattttggccggttgtagggccacaatgcagc
ctatatgttcctgctccgattcttcgccttgggaagaatgtactggtgattgttgagtta
gaatctccaaatggcgagggtgttgtacattctgttgatcggccagacgtctcctgtggg
gattcttcctactccaatttatctcagcttttaacccaccaacactctcctcgcctttga

DBGET integrated database retrieval system