KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111804775Help
Entry
111804775         CDS       T05351                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cpep00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    111804775
Enzymes [BR:cpep01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     111804775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 111804775
NCBI-ProteinID: XP_023545334
LinkDB All DBs
Position
LG11
AA seq 152 aa AA seqDB search
MVKAVAVLGNSECVIGTIFFSQEGDGPTTVTGDVSGLKAGLHGFHVHAMGDTTNGCMSTG
PHFNPAGKQHGAPEDENRHAGDLGNITVGEDGKASFTITDNQIPLSGPNSIIGRAVVVHA
DPDDLGKGGHELSLSTGNAGARVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggctgttcttggaaatagcgagtgtgttattggaactatctttttc
tcccaagaaggagatggtccaaccacggttacgggcgatgtttctggtctcaaggctggg
cttcatggattccatgttcatgccatgggtgacacaaccaacggctgcatgtcaactgga
ccacatttcaaccctgctggaaaacagcatggtgctcccgaggacgagaatcgccatgct
ggtgatttagggaacattactgttggtgaagatggaaaggctagctttaccattactgat
aaccagattcctctctctggacctaactccattatcggaagggctgttgtggtccatgct
gaccccgacgatcttggcaagggtggacatgaactcagcttatctactggaaatgctggt
gctagagtagcctgtggcattattgggttgcaaggttga

DBGET integrated database retrieval system