KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111805175Help
Entry
111805175         CDS       T05351                                 

Definition
(RefSeq) hexokinase-1-like isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00010  Glycolysis / Gluconeogenesis
cpep00051  Fructose and mannose metabolism
cpep00052  Galactose metabolism
cpep00500  Starch and sucrose metabolism
cpep00520  Amino sugar and nucleotide sugar metabolism
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
cpep01200  Carbon metabolism
Module
cpep_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cpep_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111805175
   00051 Fructose and mannose metabolism
    111805175
   00052 Galactose metabolism
    111805175
   00500 Starch and sucrose metabolism
    111805175
   00520 Amino sugar and nucleotide sugar metabolism
    111805175
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    111805175
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cpep04131]
    111805175
Enzymes [BR:cpep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     111805175
Membrane trafficking [BR:cpep04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    111805175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 111805175
NCBI-ProteinID: XP_023545870
LinkDB All DBs
Position
LG11
AA seq 498 aa AA seqDB search
MGKVAVGTAAVCAGAVCAAAALVVRHRVKNSGKWARAMAILKEFEEKCGTPIGKLRQVAD
AMAVEMHAGLASEGGSKLKMLISFVDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDGR
VLKQEFEEVSIPPHLMIGSSEALFDFIAQALAKFVAKEGEGFCLAPGRQRELGFTFSFPV
RQISISSGALIKWTKGFSIEDTVGEDVVGELTKAMEKLKLDMRVTALVNDTIGTLAGGRF
HDSDVIAAVILGTGTNAAYVERANAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDQ
ELDADSLNPGEQIFEKLISGMYLGEIVRKVLIKMAEEAALFGETVPPKLNIPFILRTPHM
SAMHHDTSPDLKVVGSKLKDILEISNTSLKTRKIIVELCDVVATRGARLSAAAILGILKK
LGRDTVGNGEKRRSVVALDGGLYEHYTKFRTTMESTLKELLGDEVAGNIVIEHSNDGSGI
GAALLAASHSQYLEVDEP
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggttgcagtaggcacggcggcggtgtgtgcaggtgcggtttgcgcggctgcg
gcgctagtggtgcgccaccgcgtgaaaaactccggtaagtgggctcgagcaatggccatt
ctgaaggagttcgaggaaaaatgtggaacccctattgggaaactgaggcaggtggctgat
gccatggccgttgagatgcacgctggcctcgcttccgaaggtggtagcaaactcaagatg
ctgattagcttcgtcgataatctcccaaccggagatgaaaaggggctgttctatgcattg
gatctcggtggtacgaactttcgagtgttacgagtgcagttgggagggaaggacggtcga
gttctgaagcaagaattcgaggaggtttcgatacctccacacttgatgattgggtcttca
gaagctctgtttgattttatagctcaagcacttgcaaagtttgttgctaaagaaggtgaa
ggcttttgcttggcaccgggtaggcaaagggaactcggttttactttctccttccctgtg
agacaaatctcgatatcatcaggggcgcttattaaatggacgaaaggcttcagcatcgaa
gacacggttggggaagacgtcgtcggtgaattaaccaaagccatggaaaaattgaaactc
gacatgcgtgtaacagcgttggtaaatgacacgattggaacattagcaggaggtcgattc
catgatagtgatgtgattgctgctgtgattttgggcactggaacgaatgcagcttatgta
gagcgtgccaatgcgattcccaagtggcacgggctacttccgaaatcaggagaaatggta
attaacatggaatggggtaacttccggtcctcgcatctgccacttacagaatatgatcaa
gaattggatgctgatagcttaaaccctggagaacagattttcgagaagttgatttctggt
atgtacttgggagaaattgttcgtaaagttttgatcaagatggctgaagaagcggcgctc
ttcggagaaaccgttccaccgaaactgaacattccatttatattgagaactcctcacatg
tctgcgatgcaccacgatacgtctcccgacctcaaagtcgttggaagcaaactgaaggat
atcttggagatatctaatacctccttgaaaacaagaaaaatcatagtggagctctgtgac
gtagttgcaacacgaggcgctcgcctatcggctgctgctatcttaggaatcctgaagaaa
ctgggaagagacacagtcggaaatggggagaagcggaggtctgtggtagcgttggatgga
gggttgtatgagcactacactaaattcagaaccaccatggaaagtacactgaaggagctg
ctcggagatgaggtagcgggaaacatcgtcatcgagcattcgaatgatggttctggcatc
ggagctgcactgcttgcagcctcgcactctcaatatcttgaggtagatgagccctaa

DBGET integrated database retrieval system