KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111807312Help
Entry
111807312         CDS       T05351                                 

Definition
(RefSeq) probable acyl-activating enzyme 16, chloroplastic isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00061  Fatty acid biosynthesis
cpep00071  Fatty acid degradation
cpep01100  Metabolic pathways
cpep01212  Fatty acid metabolism
cpep04146  Peroxisome
Module
cpep_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111807312
   00071 Fatty acid degradation
    111807312
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111807312
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cpep01004]
    111807312
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpep04147]
    111807312
Enzymes [BR:cpep01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     111807312
Lipid biosynthesis proteins [BR:cpep01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   111807312
Exosome [BR:cpep04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   111807312
  Exosomal proteins of breast cancer cells
   111807312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 111807312
NCBI-ProteinID: XP_023548745
LinkDB All DBs
Position
LG12
AA seq 734 aa AA seqDB search
MAMALPFTSSQLSWRSPDCSQSLPFLFSRYRLTGPYLLKSCVGSGARRSANRDCRVFCQS
NETETLQLRRYSPLLESSFVPGNSATVSDDWQAVPDIWRSSAERYGDRVALVDPYHNPAS
KMTYKELEQSILNFSEGLRAIGIKPDEKIALFADNSCRWLVADQGIMTMGAINVVRGSRS
SSEELLQIYNHSESVALVVDNPELFNRIVETFHLKASMRCVILLWGEKSSLAHEGMDGIA
VFDYNDIVDMGQKCRKVMLDSHDAKQHYTYEAISLDDIATLVYTSGTTGNPKGVMLTHRN
LLHQIKNLWDVVPAKVGDKFLSMLPPWHAYERACEYFIFTFGVEQAYTTIRNLKDDLRQY
QPDYLISVPLVYETLYSGIQKQISASSNARKLLVLAFMKVSLVYMKLKRIYEGTYLTRSE
VQPSHIVSALDWLFARTAAAILWPIHMLAKKLVYSKVQSAIGIWKAGISGGGSLPSHVDL
FFEAIGITVQNGYGLTECSPVIAARRPTCNVLGSVGHPIRHTEFRIVDMETGDVLPPGSR
GIVEVKGPQVMKGYYKNSSATQQVLHEEGWFSTGDIGWIAPHHSIGRSRRCGGVIVLDGR
AKDTIVLLTGENVEPTVLEEAAMRSSLIQQIVVIGQDQRRLGAIIVPNEEEVLSAARKLS
VADSSTADFSNQTLKNLIYSEVRKWTSECPFQIGPILIVNEPFTIDNGLMTPTMKVRRDK
VAGYYKNEIENLFK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggctatggcgcttccctttacctccagtcaactctcatggagatctcccgactgttcc
caatctctccctttcctcttctctcgttatcgcctcactggtccgtatttgcttaaaagt
tgcgttgggagtggagctcggcgttcagcaaaccgtgattgtcgagttttttgccaatct
aatgagacagagacattgcagttaaggagatattctccactcctcgaaagttctttcgtg
ccaggtaatagtgcaacagtatctgatgactggcaagcagttcctgatatttggaggtct
tcagcagagaggtatggcgatcgggtagcattagtggatccataccataatcctgcttca
aaaatgacttataaggagttagaacaaagtatcttgaatttctctgaaggccttagagcc
attggaataaagccagatgaaaagattgcactctttgctgataattcatgtcgatggctt
gttgctgatcaaggtattatgacaatgggagcaattaatgttgttagaggttcaagatca
tctagtgaggagctgttgcaaatatacaatcactctgaaagtgtagcattagttgtggac
aaccctgaattgttcaatcgaattgtagaaacattccatttgaaggcatccatgagatgt
gtcattcttctatggggagaaaaatctagcctggctcatgagggaatggatggcattgca
gtttttgattacaatgacatcgtggatatgggacaaaagtgtcgtaaagttatgcttgat
tctcatgatgctaagcagcattatacatatgaagctatcagcttggatgatattgctaca
cttgtatatacaagtggcacaactggaaaccctaaaggtgtcatgcttacccatcgaaat
ttattgcaccagataaagaatttgtgggatgtagtgcctgctaaagttggggataaattt
ctaagtatgcttccaccttggcatgcatacgaacgggcttgtgaatatttcatatttaca
tttggagtggagcaagcttacacaacaataagaaacttaaaggacgatcttcgtcaatat
caaccagactacttgatttctgttccattggtgtacgaaacactatacagtggaattcag
aagcaaatatcagcaagctcaaatgcacgtaagcttcttgtgcttgcattcatgaaggtc
agcttagtttatatgaagctgaagaggatctacgagggaacctatctaacaagaagcgag
gttcaaccttctcatattgtatctgcattggactggttatttgcaagaacggctgctgca
atattgtggccaattcatatgctggcaaaaaaattagtctatagcaaagttcaatctgca
attggcatatggaaggcaggcataagtggagggggcagtttaccttcacatgttgatctt
ttttttgaggcaattggcattacagtgcagaatggttatggtttaacagaatgttctcct
gtaattgctgctcgacgacctacctgcaatgttcttggttcggttggacatccaattcgg
catacagagtttaggattgtagatatggaaacaggagatgttctcccacctggatcaaga
ggcattgttgaagttaagggacctcaagtgatgaaaggttactataagaattcatctgcc
acacaacaagtcttgcacgaagagggttggtttagcactggggatatcgggtggattgct
cctcaccattcgataggccggagtcgtcgttgtggaggtgtaattgttcttgatgggcgg
gcaaaagatactatagttctcttaacaggtgaaaatgttgaaccaacagtgcttgaggaa
gctgccatgagaagtagtctcatacaacaaattgtggttattggccaggatcaacgacgg
ctaggagcgattatagttccgaatgaggaagaagtattatctgcagcaaggaaattgtct
gttgcagattcaagtacagctgattttagcaatcaaacattgaaaaatctgatttacagt
gaagtgagaaaatggacttcagaatgtccatttcaaattggaccaatcctcattgtcaat
gaaccattcacaatcgacaacggtttaatgacccctacaatgaaggttcgaagagacaaa
gttgctggttattacaagaacgaaattgagaaccttttcaagtaa

DBGET integrated database retrieval system