KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111809039Help
Entry
111809039         CDS       T05351                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00564  Glycerophospholipid metabolism
cpep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111809039
Enzymes [BR:cpep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     111809039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox NAD_binding_8 FAD_binding_3 Pyr_redox_3 GIDA Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 111809039
NCBI-ProteinID: XP_023551128
LinkDB All DBs
Position
LG13
AA seq 629 aa AA seqDB search
MATATRLGKIAVAAVATAAGGSILLQPSLASNDRGTSGHALESYRNKINDLTAVVPPRSV
QESALIGASPVNPLDILVVGGGATGCGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYKQLKLVFHALEERKQFIENAPHLCHALPCMTPCFDWFEVIYYWIG
LKMYDLVAGSRLLHLSRYYSAQESVELFPTLARNGQGRSLKGTVVYYDGQMNDSRVNVGL
ACTAALAGAAVLNYAEVVGFLKDEGSDRIIGATIRDKLSGREFDTYAKVIVNAAGPFCDS
VRKMADKEAVSMICPSSGVHVVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTGITMVPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLAIDPSAKNTESISR
DHVVCEDYPGLVTITGGKWTTYRSMAEDAVNAAIKSGKLKPTNECVTNKLRLVGGDGWGP
AYFTVLAQQYLRMKKSHSGKVVPGVMDTAAARHLSLAYGILGEKVAAIAQNENLGKRLAH
GYPFLEAEVAYCARHEYCESAVDFIARRSRLAFLDTDAANHALPRVIEILADEHNWDKKR
QKQELQKAKQFLETFKSSKNAHFHDGKHS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccacagccacacggctgggtaagatcgccgttgccgccgtagccaccgctgccggc
ggatcaatcctgcttcagccttctctcgcttctaatgaccgtggtaccagtggtcacgct
ctcgagtcatacaggaacaagatcaatgatctgactgcagttgttccgccccgatcggtt
caggagtcggctctgatcggtgccagccctgtcaatcctcttgacattcttgttgttggt
ggaggcgccactggatgtggcgtcgcgctcgatgccgttactcgaggacttcgcgtaggc
ctcgttgagcgcgaggatttctcatccgggacgtcttcgcgctctaccaagctcattcat
ggaggcgtgcggtatttggagaaagcagtgttcaatttggattacaagcagcttaaattg
gtgtttcatgcgcttgaggagcgaaaacagtttattgaaaatgcaccacacctatgccat
gcgttgccgtgcatgacaccttgttttgactggttcgaggtcatctactattggattggg
ttgaagatgtacgatttggttgcagggtctcgcctcttgcacttgtctcggtactattct
gcccaggagtccgtggagctcttccctacccttgctaggaatggtcagggcagaagtttg
aaaggcaccgttgtgtattacgatgggcagatgaatgactcgcgggtcaatgtggggctt
gcttgtactgccgctctggctggtgcggcggtgctgaattatgcagaagtcgtgggattt
ttgaaggatgagggcagtgatcgaatcatcggagcgacaattcgtgacaagttgtcaggt
agagagtttgatacctatgcaaaggtgattgtcaatgctgctgggccattttgtgactca
gtgagaaagatggccgataaagaggcagtgtctatgatctgtcccagcagtggtgttcat
gtagttctccctgattattattctcccgaaggaatgggtctgattgttcccaagaccaag
gatgggcgtgttgtttttatgctgccatggttaggacgaacagttgctggaaccacagat
tccaacactggcatcactatggttcctgagccacacgaggatgaaattcagtttatactg
gatgcaatctctgattaccttaacgtgaaggtgcggcgaacagatgttctctcagcttgg
agtggtattcgtcctttggctatagatccgtcagctaaaaatacggagagcatctcaaga
gatcatgttgtttgtgaagattatcccggattggtcacaattactggcgggaaatggact
acttatcggagcatggcagaagatgctgttaatgcagctataaagtccggaaagctgaag
ccgacaaatgaatgtgtaactaacaagctgcgacttgttggtggagatggatggggacct
gcatattttactgtcttagctcaacaatatttacgcatgaagaagagtcatagtggtaaa
gttgtccccggagttatggacactgcagctgcaagacatttatctcttgcgtatggcatt
ttaggtgaaaaagtggccgctatagcccagaatgagaatttgggtaagcggttagcccat
ggctaccccttcttggaggctgaggttgcatactgtgctcggcatgagtactgtgaatct
gcagtagatttcatcgccagaagatcacggctcgctttccttgatacggatgctgctaat
cacgcattgcctcgggtaatcgagatattagcagatgaacataattgggacaagaaaaga
cagaagcaagaactacagaaggccaagcagttcttagaaactttcaagtcttcaaagaat
gcccacttccacgatggaaagcacagttag

DBGET integrated database retrieval system