KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111810124Help
Entry
111810124         CDS       T05351                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00020  Citrate cycle (TCA cycle)
cpep00190  Oxidative phosphorylation
cpep01100  Metabolic pathways
cpep01110  Biosynthesis of secondary metabolites
cpep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111810124
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111810124
Enzymes [BR:cpep01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111810124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 111810124
NCBI-ProteinID: XP_023552475
LinkDB All DBs
Position
LG14
AA seq 635 aa AA seqDB search
MWRCVSRGLRASSSSFSRKSSPNDHLRSHFSRFFSDSTAGRSSYTVVDHTYDAVVVGAGG
AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
WLGDQDAIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCAC
AADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNTEDGTLHRFQAA
STILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEG
SRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNH
LPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPD
AVIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGAKQKPLENDAG
EKTIAWLDKLRNANGSLPTSNIRLNMQRIMQNNAAVFRTQETLEEGCKLIDKTWESFHDV
KVKDRSLIWNTDLIETIELENLLINASITMHSAEARKESRGAHAREDFTTRDDVNWMKHT
LGFWENEKVRLDYRPVHMNTLDDEMETIPPKARVY
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgtgtttctcgtggccttcgcgcttcttcttcttccttttctaggaaatcg
tcgcctaatgatcacctcagatctcacttttctagattcttctccgattcgacggcaggt
cgctcgtcatatactgtggttgatcacacatacgatgcggttgtggtaggagccggtggt
gcagggcttcgagctgctataggattgtcagaacatggatttaatactgcctgcattact
aagcttttcccaactcgatctcacactgttgcagctcagggaggtattaatgctgcactg
gggaacatgactgaggatgattggaggtggcacatgtacgacactgtcaaggggagcgat
tggctaggtgatcaggatgccattcaatacatgtgtagagaagcaccaaaagcagttatt
gagcttgagaattatggacttccattttctcgtactgaagagggaaaaatatatcaacgt
gcatttggtggtcagagcctcgactttggaaagggtggacaggcatatcgttgtgcatgt
gctgctgaccgaacggggcatgctttattgcatactctctatggccaggctatgaagcat
aacacacaattttttgtggaatattttgctttggatcttttaatgaatagtgatggtagc
tgccagggagtgatagcattaaatacagaggatggtacactacatcggttccaagctgca
tcaacaattttagctactgggggttatggcagagcatatttctctgcaacctctgctcat
acctgtactggagatggaaatgccatggttgcacgtgctgggcttccacttgaggatttg
gagtttgtgcagtttcatccaacaggaatatatggtgctggatgccttattactgaagga
tctcgtggtgaaggaggcattcttaggaacagtgaaggtgagcgctttatggaacgatat
gccccaacagcaaaggatcttgcatcaagggacgttgtctcaagatccatgacgatggaa
attcgggagggtcgtggtgtaggaccactgaaggaccacatctatcttcatttaaatcac
ttaccccctgaggtactgaaggagagacttccgggtatctcagaaactgctgccattttt
gctggcgttgatgttaccaaagagcccattccagtgttacctacagtgcattataatatg
ggtggaattccaactaatcatcatggagaggtagttacaatcaagggcaatgatccagat
gctgtaattccaggattgatggcggctggggaggcagcttgtgcctcggttcacggtgca
aataggcttggtgcaaattcccttttggacattgttgtctttggacgagcttgtgcaaat
agggtagcagagatcagtaaaccaggggcaaagcaaaagccgttggaaaatgatgctggt
gagaagacaattgcatggctagacaaattaaggaacgcaaatggttcacttcccacctca
aatattcggttgaacatgcaacgaattatgcaaaacaatgctgctgtcttccgaactcag
gagaccttggaagaaggttgcaaattaattgacaagacatgggagagtttccatgatgtg
aaggtcaaggacaggagtttaatatggaacactgatttgattgagacaattgaattggaa
aatcttttgatcaatgcctctattaccatgcactctgctgaagccaggaaagagagcaga
ggagcacatgctcgtgaagatttcacaacaagagatgatgtgaactggatgaagcacaca
ttgggattctgggagaatgagaaggtcaggctggactataggccagtgcacatgaacaca
ttggacgatgagatggaaacaatccctcccaaggcccgtgtatactga

DBGET integrated database retrieval system