KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111810563Help
Entry
111810563         CDS       T05351                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Pathway
cpep00040  Pentose and glucuronate interconversions
cpep00051  Fructose and mannose metabolism
cpep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    111810563
   00051 Fructose and mannose metabolism
    111810563
Enzymes [BR:cpep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     111810563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AlaDh_PNT_C PALP UDPG_MGDP_dh_N Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 111810563
NCBI-ProteinID: XP_023553050
LinkDB All DBs
Position
LG14
AA seq 365 aa AA seqDB search
MGKGGMSQGGSGEDGVEENMAAWLLGVNTLKIQPFHLPPLGPHDVRVKMKAVGICGSDVH
YLKTLRCAHFVVREPMVIGHECAGIIAEVGAEVKHLVPGDRVALEPGISCWRCDLCKDGR
YNLCPEMKFFATPPVHGSLANEVVHPADLCFKLPENVSLEEGAMCEPLSVGVHACRRANV
GPETNVLVMGAGPIGLVTMMAARAFGAPRIVIVDVDDFRLSVAKDLGADEVIKVSVDIQD
VDQDVAQIQKAMKAEVDVSLDCAGFNKTMSTALSATRAGGKVCLVGMGHNEMTVPLTPAA
AREVDVIGVFRYKNTWPLCLEFIRSGKINVKPLITHRFGFSQKEVEDAFETSACGGNAIK
VMFNL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggaggaatgtctcagggcggcagtggggaagatggagttgaagagaatatg
gctgcttggcttttgggtgtcaataccctgaagattcaaccttttcaccttcctcctctt
gggccccatgatgttcgagttaagatgaaggctgttggtatctgcggcagtgatgttcac
tacctcaagacattgagatgtgcacattttgtcgtcagagagccaatggtcatcgggcat
gaatgcgctgggattatcgcagaagttggagctgaagttaagcatttggtgccgggggat
agggttgcgctggagcctggaattagttgctggagatgtgatctctgcaaagatggccgc
tacaatctgtgcccagagatgaagttctttgccactccccctgttcatggttctcttgca
aatgaggtggttcatcctgcagacctgtgttttaaactgccggaaaatgtcagcttagag
gaaggagccatgtgtgagcccttaagtgtaggtgttcatgcttgtcgacgtgctaacgtt
ggtccagaaacaaatgttttggtcatgggagctggaccaattgggcttgtcactatgatg
gctgcccgggcatttggtgcaccacggattgtcattgttgatgtcgatgactttcgatta
tctgttgcaaaggacctgggagcagatgaagttattaaagtttcagttgacattcaggat
gtagatcaagatgttgctcagatacaaaaagccatgaaagctgaggtagatgtgagcttg
gattgtgctggctttaacaagacaatgtcaacagctttaagtgccacccgagctggtggc
aaagtttgtctcgtgggaatgggtcacaatgagatgactgttccactaactccagctgca
gcaagggaagtcgacgtgatcggtgtgtttcgttacaagaacacatggcctctgtgcttg
gagtttataagaagtggtaagatcaatgtgaagccgcttataactcacagatttggcttc
tcacagaaggaggtggaagatgcctttgaaaccagtgcttgtggcggtaatgctattaag
gtcatgttcaacttgtga

DBGET integrated database retrieval system