KEGG   Cucurbita pepo subsp. pepo (vegetable marrow): 111810670Help
Entry
111810670         CDS       T05351                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53-like isoform X1
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
cpep  Cucurbita pepo subsp. pepo (vegetable marrow)
Brite
KEGG Orthology (KO) [BR:cpep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cpep03009]
    111810670
Enzymes [BR:cpep01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111810670
Ribosome biogenesis [BR:cpep03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    111810670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL
Motif
Other DBs
NCBI-GeneID: 111810670
NCBI-ProteinID: XP_023553182
LinkDB All DBs
Position
LG14
AA seq 512 aa AA seqDB search
MGFWGIEVKPGKPYPYHSDNVPGKLRITQATLGPGSSKERSIIQCSVGQKSPIFLCSLIP
NKIESCPLNLEFEEDDLIAFSVIGPQSIHLSGYFVANEGNFIRDDYESDSFGEDIAETDT
EDSSEYDTGDEYDDEFIDDDDDDYPGMFPTSPVNKSGVVIEEIVDDEKSNDANGQAKEVK
RTKSSDSEDIRNSQRQVVLKRNVGKAISESEDEDGFPISTKSKSKANMQKLEPEQEQKGP
STGNVKEAKAKDGNDASSLKRKVENDEQVDHMESDVRKKKKKQKKKVKEVKALETGNDGN
MGREKPPAEVESAAVNPTSDGDENGKKLSKQRDASTHMDVADGENQKEDKQKKKKKKKEK
KSKETEIGSKSDELTKTAGGQSKSALSSKEKEKESKSSRVRTFANGLVIEEVAMGKPDGK
RASPGNQVSVHYIGKLKNGKIFDSNVGRAPFKFRLGLGQVIKGWDVGVNGMRIGDKRRLT
IPPSMGYGAAGAGGKIPPNSWLTFDVELVGVR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctggggcattgaagtgaaaccaggcaaaccgtacccttaccattctgataac
gtgccgggaaaactccggataactcaggcaactttgggacctggctcatcgaaagagaga
agcatcattcagtgttctgttggtcagaagagtccaatttttttgtgctctttgatacca
aataagattgaatcatgccccttgaatcttgaatttgaggaagatgatttgatagccttc
tcagttattggcccacaaagcatccatctctctggttattttgtagccaacgagggaaat
ttcatcagggatgactatgagtctgattcttttggggaagacatcgcggaaacagatacc
gaggattcatcagagtatgacactggagatgaatacgatgatgaattcattgatgacgac
gatgatgactatcctgggatgttcccaacttcgccagttaacaaaagtggagttgtaatt
gaggagatagtggatgatgaaaaatccaatgatgccaatggtcaagctaaagaagtgaag
agaactaagtccagtgactctgaagatattaggaactctcagcgtcaagttgtgctgaaa
aggaatgtgggaaaagctatttcagaaagtgaagatgaagatggatttccaatttctacc
aaaagcaagagcaaagcgaatatgcagaaattagaaccagagcaggaacaaaaaggtccc
agtactgggaatgtgaaggaggcaaaagcaaaagatggcaatgatgcttctagcttgaaa
agaaaagttgaaaacgatgagcaagttgatcatatggaaagtgatgtcaggaaaaagaaa
aagaagcagaaaaaaaaggtaaaagaagtaaaagctctggaaactggtaatgatggtaat
atggggcgcgaaaagccaccagcggaagttgagagtgcagctgttaatccaacttctgat
ggagatgagaatggcaaaaagctatctaaacagagggatgcctcgactcacatggacgtt
gctgatggtgaaaatcagaaggaagataagcaaaaaaagaagaaaaagaagaaggagaag
aagagtaaggagactgaaattggatcaaaatctgatgaactaacgaagacagcaggaggt
cagagtaagtcagctttgagttcaaaagagaaggaaaaagaatccaaatcatctcgagtg
agaacttttgctaatgggttggttattgaggaggtagccatgggtaaaccagatggtaaa
agagcttcacctggaaaccaggttagtgttcactatattgggaagctaaagaacggcaaa
atatttgatagtaatgttggaagggcaccattcaaattccgcttaggtctgggacaggtt
attaagggatgggatgtcggggttaatggtatgcgaattggggataaaaggagattgaca
atccctccatcaatgggttatggggctgcgggagctggtgggaagattccaccgaattct
tggcttactttcgatgttgaactggttggtgtccgctga

DBGET integrated database retrieval system