KEGG   Clostridium perfringens ATCC 13124: CPF_2051Help
Entry
CPF_2051          CDS       T00378                                 

Gene name
narB
Definition
(GenBank) nitrate reductase electron transfer subunit
  KO
K00196  anaerobic carbon-monoxide dehydrogenase iron sulfur subunit
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
cpf00680  Methane metabolism
cpf01100  Metabolic pathways
cpf01120  Microbial metabolism in diverse environments
cpf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpf00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CPF_2051 (narB)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CPF_2051 (narB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Fer4_6 Fer4_9 Fer4_10 Fer4_7 Fer4_15 Fer4_2 Fer4 Fer4_16 Fer4_21 Fer4_13 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ABG83201
UniProt: A0A0H2YQQ6
LinkDB All DBs
Position
complement(2290364..2290777)
Genome map
AA seq 137 aa AA seqDB search
MKRIKINRDKCVGCLTCTTACIVSHDSEDTRSRIAITSEGKYTPIFCRHCDRPECVYTCM
SGAMKKDKETGFVTYDKSRCASCFMCVMACPYGVLKAEHEMNKYIMKCDMCASTKEKTPQ
CVAKCPMGAITLEEVEE
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagaataaaaatcaatagagataaatgcgtgggatgcttaacatgcacaactgct
tgtatagtttctcatgattcagaggatacaagaagtagaattgcaataacaagtgaagga
aaatacactcctattttctgtagacactgtgatagaccagagtgtgtttacacttgtatg
agtggtgctatgaagaaagataaagaaactggttttgtaacttatgacaaatcaagatgt
gcaagttgctttatgtgtgtaatggcttgcccatatggagtattaaaagctgaacatgaa
atgaataaatatataatgaaatgtgatatgtgtgcaagtacaaaagaaaaaactcctcaa
tgcgttgcaaaatgtccaatgggagcaataactttagaggaggtagaagaataa

DBGET integrated database retrieval system