KEGG   Clostridium perfringens ATCC 13124: CPF_2315Help
Entry
CPF_2315          CDS       T00378                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
cpf00250  Alanine, aspartate and glutamate metabolism
cpf00410  beta-Alanine metabolism
cpf00430  Taurine and hypotaurine metabolism
cpf00650  Butanoate metabolism
cpf01100  Metabolic pathways
cpf01110  Biosynthesis of secondary metabolites
cpf01120  Microbial metabolism in diverse environments
cpf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CPF_2315
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPF_2315
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CPF_2315
   00430 Taurine and hypotaurine metabolism
    CPF_2315
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CPF_2315
Enzymes [BR:cpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CPF_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABG82826
UniProt: A0A0H2YR00
LinkDB All DBs
Position
complement(2564797..2566191)
Genome map
AA seq 464 aa AA seqDB search
MLFGKNELGSQFETPIFGTVESNESIPKYELAKKSIAPQVAYRLIKDDLLDEGNARQNLC
TFCQTYMDDEAVKLMAETLEKNAIDKSEYPQTTDLENRCVNILADLWHAPKDESFMGTST
VGSSEACMLGGMAMKFRWRNRAKALGMDVTSRKPNLVISSGYQVCWEKFCVYWDIEMRLV
PMDEEHMSINVDKVLDYVDDYTIGVVGILGITYTGKYDDIKALDKKLEEYNKTAKLTVPM
HIDAASGGMFAPFIEPELEWDFRLKNVVSISTSGHKYGLVYPGIGWVLWRDKEYLPQELV
FDVSYLGGKIPTMAINFSRSASQIIGQYYNFLRYGFEGYRQIHQRTKDVAMFLASELEKT
GLFQIYNNGENLPIVCYKLRDDVNVDWTLYDLADRLLMKGWQVPAYPLPADLQDTIIQRI
VCRADLSHNLAELYLRDLKAAIEDLNNARVLNQKSKTGVQGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgctttttggaaaaaatgaattaggtagtcaatttgaaacaccaatatttggtactgtg
gaaagtaatgaatctattcctaaatatgaattagctaaaaaatcaattgcacctcaagtt
gcatatagattaattaaggatgacttactagatgaaggtaatgctcgtcaaaacttatgt
actttctgtcaaacttacatggatgatgaagctgtaaaattaatggcggaaacattagaa
aaaaatgctatagataaatcagaatatcctcaaacaactgatttagaaaatcgttgtgta
aatatattagcagatttatggcatgcaccaaaggatgaaagtttcatgggaacttcaaca
gttggatcatcagaagcttgtatgcttggtggtatggctatgaaatttagatggagaaat
agagctaaagctttaggtatggatgttacatcaagaaaaccaaacttagtaatttcttca
ggataccaagtatgttgggaaaaattctgtgtttactgggatatagaaatgagattagtt
ccaatggacgaagaacatatgagcataaatgtagataaagttttagactatgttgatgat
tatacaattggtgtagttggaatactaggaattacttacactggtaaatatgatgatatt
aaagcattagataaaaaacttgaagagtataataaaactgcaaaattaacagttccaatg
catatagatgctgcttcaggtggtatgtttgctccatttatagaaccagaactagagtgg
gacttcagacttaaaaacgttgtttcaataagtacatcaggtcataaatatggactagtt
tatcctggtataggttgggtattatggagagataaagaatacttaccacaagaattagta
tttgacgtaagctacttaggaggaaaaataccaacaatggcaattaacttctcaagatca
gctagccaaattataggtcaatattataacttcttaagatatggatttgaaggatataga
caaatacatcaaagaacaaaagatgttgctatgttcttagcatctgaacttgaaaaaact
ggattattccaaatatacaataatggtgaaaacttaccaatagtttgttataaattaaga
gatgatgtaaatgttgattggacattatatgatctagcagatagattattaatgaaagga
tggcaagtaccagcttacccattaccagcagacttacaagatacaataattcaaagaatt
gtttgtcgtgctgaccttagccataatttagctgaattatacttaagagacttaaaagca
gctatagaagatttaaataacgcaagagttttaaatcaaaaatctaaaacaggagtacaa
ggatttactcactag

DBGET integrated database retrieval system