KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0559Help
Entry
Cpha266_0559      CDS       T00439                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00620  Pyruvate metabolism
cph00680  Methane metabolism
cph00720  Carbon fixation pathways in prokaryotes
cph01100  Metabolic pathways
cph01120  Microbial metabolism in diverse environments
cph01200  Carbon metabolism
Module
cph_M00168  CAM (Crassulacean acid metabolism), dark
cph_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
cph_M00614  Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cpha266_0559
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cpha266_0559
   00680 Methane metabolism
    Cpha266_0559
Enzymes [BR:cph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cpha266_0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABL64615
UniProt: A1BDY8
LinkDB All DBs
Position
complement(625602..628370)
Genome map
AA seq 922 aa AA seqDB search
MITTTSSVINFEKAERDFTFLLQCFQEMLHDLGEKELAEHLPWKRASMRLDDYPDIERAI
QAYSIFFQLLNMAEENSGAQYRRTIETEKGLSELKGLWGKNLHRLKKNGITEEEILSELS
RVTVDVALTAHPTEAKRKTVLEQHRQLYILLVKRENQMWTPLEQEDIRKEIKVVMERLWR
TGELLYDKPAVSAERRNIVHYLYNIFPEVLPMLDKRLLHAWQECGFAPEKLADPQTLPLL
RFGSWVGGDRDGHPLVTAKVTRETLLEMRRKALALIAFHLTRLASKLSLSEKHQLPPDAL
EERIRTLANHLGEDGEVALIRNRHEPWRQFINLMIASLPKNPRNEHDTGNQNDIFSYGSS
RELLDDLELLRQSLLNVGARHIADSDVAPVYRIVQTFGFHLASLDIRQNSEFHDLALSQL
MSAAGLNGSAFLTWNEEERTAFLDRELQSPRPFTHPDMKAGPEAEAVLDCYRVLLDHCKE
YGSEGIGSLIVSMTRNASDLLVVYLFMREVGLMTPFKEHDACMLPVVPLFETIEDLEKSP
DIMRTFLSHPLTRRTLGMQQEMNGWEKPAQQVMIGYSDSNKDGGIFASIWNLYRAQESLL
EAGKKSETEILFFHGRGGSISRGAGPTHRFLRAQPHGSFQAGIRFTEQGETIAQKYANRI
SALYNLELFMAGVTGELLKHRNKEKTSHELEPLMDMLSRTSNLAYRRLIEAEGFIDFFRE
ATPIDIIEATRIGSRPSRRSGKKSLADLRAIPWVFSWNQARFSLSGWFGIGSALEQLQHE
HPEACDNIRRQDASWAPLRYIISNADASLATVDTEIMREYAALVENSELRSRIFGIIENE
YHKTRTMIESLYGAHLEEQRLNVSRFISLRQEGLRELHRQQIRLLKKWRKLHQTGQNKKA
DNLLAELFLTVNAISGGLRTTG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccacgacaagcagcgtcattaattttgaaaaagcggaaagggacttcaccttt
ctgctccagtgttttcaggaaatgcttcatgatctgggcgaaaaagagcttgccgaacat
cttccgtggaaacgggcgtccatgcgcctcgatgattatcccgacattgagcgagccata
caggcatactcgatttttttccaactgctcaacatggcagaagaaaactcaggcgcgcag
tatcgacgcacaattgaaacagaaaaaggactatcggagctcaagggactctggggaaaa
aacctgcatcggctcaaaaaaaacggcataaccgaagaggaaattttgagcgaactatcg
cgggtcaccgtcgatgtcgccctgacagcccaccccaccgaggcaaaacgaaaaaccgtt
cttgaacagcaccgccagctctacattcttctggtaaaacgtgaaaaccagatgtggaca
ccacttgaacaagaggatatccgtaaagagataaaggtcgtcatggaaagattgtggcga
accggtgagctcctgtacgacaaaccggccgtatcggctgaacgcagaaatattgttcac
tacctctataacatttttcccgaagtgctgcccatgcttgacaaacggcttcttcacgca
tggcaggaatgcgggttcgctcccgaaaaactcgcagacccgcaaacgcttcccctgctt
cgttttggaagctgggttggcggcgacagggacggccaccctcttgtcaccgcaaaagta
accagagagacccttctggaaatgcgtcgcaaagcgcttgccctgatcgcctttcatctt
accaggcttgcctcaaagctcagcctgtctgaaaaacaccagttgcccccggacgcactg
gaagaaagaatcagaacgctcgccaaccatctgggagaagatggcgaggtggcactcata
agaaaccggcatgagccatggcgccagttcataaatctcatgattgcatccctgccgaaa
aacccccggaacgaacatgacacaggaaaccagaacgacatattctcgtacggttcttcg
cgtgagctgctcgacgaccttgagctgttgcgacaatccctgcttaacgtaggagcccgg
catattgccgattccgatgtggctccggtctatcgcattgttcagactttcggcttccat
ctggcatcactcgatatccggcaaaacagcgagtttcacgatctggccctctctcagctt
atgagcgctgccggcttgaacggaagtgcatttctgacctggaatgaagaagaacgaaca
gcctttcttgacagggagctgcaatcaccccgaccgttcacccatcccgatatgaaagcc
ggccctgaagccgaggcggttctcgactgctatcgggttcttctggaccattgcaaggag
tatggaagcgaaggaataggctccctgatcgtcagcatgacaagaaatgcctccgatctt
cttgtggtctatctttttatgagagaagtcggcctgatgacccctttcaaagagcacgat
gcctgtatgcttcccgtcgtcccgctctttgaaaccattgaagaccttgaaaaaagccct
gatatcatgagaacatttctctcccatccgctcacccggcgaactcttggcatgcagcaa
gagatgaacggctgggaaaaaccggcacaacaggtgatgatcggatacagcgacagcaac
aaggacggaggaatttttgccagtatctggaacctgtaccgggcacaggagtcgttgctt
gaggccggcaaaaaatcagaaacagagatacttttctttcatggccgaggaggaagcatc
agcaggggcgctggcccgacccaccggtttttgcgagcccagcctcacggttcattccag
gcgggcatccgctttaccgaacagggtgaaacaattgcacaaaaatatgcaaacaggatc
agtgcactctacaacctcgaactcttcatggcgggagtaaccggagagctgctgaaacac
cgcaataaagaaaaaacaagccatgaacttgagccgttgatggatatgctctcacggaca
agcaaccttgcctaccgcaggctgatcgaggcagaagggtttattgattttttcagggag
gcaacgccgatagatattattgaggctacccggataggatcccgtccctcaaggcgttca
gggaaaaaaagccttgcggatttacgcgcaatcccgtgggtattcagctggaaccaggcg
aggttctccctttcaggatggttcggcatcggctcagcactcgaacagcttcagcatgaa
catcccgaagcgtgcgacaacattcgacgccaggatgcgtcatgggcacccctccgctac
atcataagcaatgcggatgcaagccttgcaacggtcgataccgagattatgagagagtat
gccgcccttgtcgaaaacagcgaactccgctcaagaatcttcggcatcattgaaaacgag
taccataaaacccgaacaatgatagagagcctctatggcgcgcatcttgaagaacaacgc
ctcaatgtctccagattcatctccctgcgtcaggaagggctcagggagctgcaccgccag
cagatccggctgctgaaaaaatggcggaagctgcaccaaacaggacagaacaaaaaagct
gacaatctgctggcagaactttttcttaccgtcaatgccatatcaggaggactgagaacc
accggatga

DBGET integrated database retrieval system