KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0983Help
Entry
Cpha266_0983      CDS       T00439                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Brite
Enzymes [BR:cph01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cpha266_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABL65030
UniProt: A1BF53
LinkDB All DBs
Position
complement(1124067..1124669)
Genome map
AA seq 200 aa AA seqDB search
MAYQQPPLPYADNALEPYISATTIGFHYGKHHATYITNYNNLVANTPLDAMTIEEVIIAT
ANDPQKIGIFNNGAQAWNHSFYWNSLSPDGGGEPGGILAEKINTDLGGFDKFREELKNAA
TTQFGSGWAWLVLDNGVLKIVKTANAGTPLTSGQTPLLAVDVWEHAYYLDYQNRRPDYVS
TTIEHLLNWEFAEKNFLAAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcagcaaccaccgcttccctatgccgacaatgcactggagccctatatttct
gcaacgaccattggttttcattacggaaaacatcatgcgacctatataacaaactacaac
aatcttgtagcaaacactccgcttgacgcgatgacgattgaagaagtcatcattgcaaca
gcaaatgacccgcagaaaatcggcattttcaacaatggagcacaagcatggaaccactct
ttttactggaacagcctctctcctgacggcggaggtgaacccgggggcatccttgctgaa
aaaatcaataccgatctcggtggattcgacaaattccgcgaagaactgaaaaatgcagcc
acaacccagttcggcagtggatgggcatggctggttcttgacaatggagtcctgaagatt
gttaaaacagccaacgccggaactcccctgacaagtggccagacaccgcttcttgctgtt
gatgtctgggaacacgcctactatcttgattaccaaaaccggagaccggactacgtatca
acaactattgaacacctgctcaactgggagttcgccgaaaaaaactttctggccgcaaaa
taa

DBGET integrated database retrieval system