KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2082Help
Entry
Cpha266_2082      CDS       T00439                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00970  Aminoacyl-tRNA biosynthesis
cph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cph00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cpha266_2082
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cph03029]
    Cpha266_2082
Enzymes [BR:cph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Cpha266_2082
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Cpha266_2082
Mitochondrial biogenesis [BR:cph03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cpha266_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ABL66094
UniProt: A1BI67
LinkDB All DBs
Position
complement(2415170..2415457)
Genome map
AA seq 95 aa AA seqDB search
MSVTKKDVAYIAELARLKFGDTEMETMTVELNNILHYIDKLNEVDTEGVQPLSSIHDESN
VLRADIEKTSISTDQVLLNAPDRQDRFFKVPKVIG
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttaccaaaaaagatgttgcctatatagccgagcttgcccgattgaagtttggc
gatacggaaatggagaccatgaccgttgagctcaacaatattctccattacatcgataaa
ctcaatgaagttgatacggagggcgtccagccgctcagcagcattcacgacgagagcaac
gttctccgggctgatatcgaaaaaacttcgatttcgaccgatcaggttctgctgaatgct
ccggacaggcaggacagatttttcaaggttcctaaagtcatcggatga

DBGET integrated database retrieval system