KEGG   Corynebacterium phocae: CPHO_09935Help
Entry
CPHO_09935        CDS       T05007                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cpho  Corynebacterium phocae
Pathway
cpho00620  Pyruvate metabolism
cpho00680  Methane metabolism
cpho01100  Metabolic pathways
cpho01120  Microbial metabolism in diverse environments
cpho01200  Carbon metabolism
Module
cpho_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cpho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPHO_09935
  09102 Energy metabolism
   00680 Methane metabolism
    CPHO_09935
Enzymes [BR:cpho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CPHO_09935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APT93155
UniProt: A0A1L7D4V8
LinkDB All DBs
Position
complement(2187070..2189754)
Genome map
AA seq 894 aa AA seqDB search
MSTATQTAEVDQVRQDIRLLGRILGEVIAKQEGQEIFELVETARTTAFAIARREKDAEAL
LDLFRERPVAETNLVARSFTFFALLANLAEDLDDEKHGDFVTLDSTFDKLKDKGVSAQQA
NEVISGALVSPVLTAHPTETRRRSIFDAQKHIKELIKATRREGVTPEIERQLTLRITLLW
QTGLIRVSRPSLEDEIKVGLRYYQLSLLEEIPALNLTVRRKYRETFDQEVDSAAMVRPGS
WIGGDHDGNPYVDGEKVAHATTQAALVALSYYERELHELERELSLTQRHSEPTAELVALA
DASNNTNALRLDEPYRRAIFGIRARIQATLDRAKGKVKKKIKAAPYNQPEELLADLAVID
HSLRAAKDDIIADDRLLKIRAAVKTFGFHLHSLDLRQNSESFENVLTEIFALNGYTDDYR
GLGEEEKIALLQEELETKRPLLFPRGSKWREQLSADTEKELGIFEAAAKAVSQFGRAAVP
HCIISMTGSVSDILEPMVLLKEYGMDEVDLVPLFETIDDLEAGASILDKLWNVPVYREHL
TRRGNKQEVMLGYSDSNKDGGYLQANWALYDAELDLVEVCRAHGVELRLFHGRGGAVGRG
GGPTYDALLAQPAGAVSGSVRITEQGEVISAQYGSPETARHHLQSFVAGVLEASLLDTEP
MKDTERAYAVMRELSALSAERYQELVGDPGFIDYFTQSTPLAEIGELNIGSRPAARKQTK
AISDLRAIPWVLSWSQQRTNVPGWFGVGSALSKWAGEDESRWDELRALYSEWPFFRTVLS
NMAQVMSKAEISLARLYADLVDDQEVAGRIYELIREEFQLTRNAYLRITGFEGLAGDNQR
QARSLKRRYPYLLPLNVIQAEMLRRYREGDDSFVVANTIRVTMNGLATALRNAG
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcaacacagaccgctgaagttgatcaagtccgccaagacatccgcctactg
ggaaggatcttgggtgaggttattgccaagcaagaaggccaggagattttcgagctggtt
gaaacggcccgtaccactgcctttgccatcgcgcggcgggaaaaggacgcggaggccctc
ctggatctattccgcgagcgcccagtggcagaaaccaatctggttgcgcgttctttcacc
ttcttcgctttgctggccaacttggcagaagacctggatgatgaaaaacacggggacttt
gtcacgctagacagcacctttgacaagctcaaagacaaaggggtctccgcccagcaagcc
aatgaggtcattagcggcgcgctggtgtccccagtgctgaccgcgcaccctactgaaacc
cgccgccgcagtatctttgacgcccagaagcacatcaaggagctcatcaaggccactcgc
cgggagggcgttaccccggagattgagcgccagctaaccctgcgcatcacgctgttgtgg
cagaccgggctgatccgggtgtcccgccccagcctggaagatgagatcaaggttggtctg
cgttattaccagctttccctgctggaggaaatcccggcgctgaacctgaccgtgcgcagg
aagtaccgggagacgttcgaccaagaagtagacagcgccgccatggtgcgccccggttct
tggattggtggggaccatgacggcaacccttacgtggacggggagaaggtggcccatgcc
accacacaggccgcgcttgtggccctgagctactacgagcgtgagctgcacgagctagag
cgcgaactttccttgacgcagcgccactcggagcccaccgcggagctcgtagcgcttgcc
gacgcctccaataacaccaacgccctgcgccttgatgagccttaccgccgcgctattttt
ggaatccgtgcccgtatccaggccaccttggaccgggccaaaggcaaggttaagaagaaa
atcaaggctgccccttataaccaaccggaggagctgctggctgacctggcagtcattgat
cactccctgcgcgcggccaaagatgacatcatcgctgatgaccgcctgctgaagatccgg
gctgcggtaaaaacttttggcttccatcttcattccctggatttgcgccagaactctgag
tcctttgaaaacgtgctcaccgaaatctttgctctcaacggatacacggatgactaccgg
ggcttaggcgaagaagaaaagattgcccttttgcaggaggagctggaaactaagcgccct
ttgctctttccccgtgggtctaaatggcgcgaacaactgagcgcggacacggagaaagaa
ctgggtatcttcgaggcagccgctaaagccgtgtcacagtttggccgtgccgccgtaccg
cattgcattatctccatgaccggcagcgtgtctgacatcctggagccaatggtcttgctc
aaggagtatggcatggatgaggtggatctggttccgctctttgaaaccatcgatgactta
gaagccggcgccagcatcctggacaagctgtggaacgtgcccgtttaccgcgagcacttg
acccgccggggcaacaagcaggaggtcatgctgggatactccgactccaacaaggacggt
ggctacctgcaggctaactgggcgctctacgacgcggagctagacctggttgaggtctgc
cgcgcccacggcgtggagctgcgcctgttccacggccgcggcggtgccgtgggccgtggc
ggcggacctacttatgatgccctcctggcccagccagccggtgccgtctccggctccgta
cgcatcaccgagcaaggcgaggtcatctccgcgcaatacggctccccggagaccgcacgc
catcacctgcagtccttcgtagccggcgtcttggaggcctccctgctggacaccgagcca
atgaaggacactgagcgcgcctacgccgtcatgcgtgagctttccgcgctgtcagccgag
cgctaccaggagttggtgggcgaccccggcttcattgactacttcacccagtccacgcca
ctggccgaaatcggtgagctcaacattggctcccgcccggccgcccgcaagcagaccaag
gccatttctgacctgcgcgccatcccgtgggtgttgtcctggtcccaacagcgcaccaac
gtgccgggctggtttggcgtgggctccgcgttgtccaagtgggccggtgaggacgagtcc
cgctgggatgagctgcgtgccttgtattccgagtggccatttttccgcacggtgctatcc
aacatggcgcaggtcatgtccaaagcggagatttccctagcccggctctacgccgactta
gtggatgaccaagaggtagccggccgtatctacgagctcatccgggaggaattccagttg
acccgcaacgcctacctgcggatcaccggttttgagggcctggcgggtgacaaccagcgt
caggcgcgctcgctcaagcgccgctacccctacctcctgccgctcaacgtcatccaggcg
gagatgctgcgccgctaccgcgaaggggatgactccttcgtggtagccaacaccatccgc
gtgactatgaacggcctggcaacggcgctgcgcaacgccggctag

DBGET integrated database retrieval system