KEGG   Cnuibacter physcomitrellae: B5808_01895Help
Entry
B5808_01895       CDS       T04797                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cphy  Cnuibacter physcomitrellae
Pathway
cphy00630  Glyoxylate and dicarboxylate metabolism
cphy01100  Metabolic pathways
cphy01120  Microbial metabolism in diverse environments
cphy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cphy00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    B5808_01895
Enzymes [BR:cphy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     B5808_01895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ARJ04110
UniProt: A0A1X9LQE1
LinkDB All DBs
Position
complement(390782..392038)
Genome map
AA seq 418 aa AA seqDB search
MTDDRIRARYLIETPVGLERAATSMAGEQSTGTFIALPGETPELHRRHAAHVESIELHET
GVDASLSGSRGPGPVERGEVVLSFPLENVGTALPNLLATVAGNLFELQQLSGIRLIDLEL
PAEFGAAHPGSQFGVDGTREIAGVPTGPIVGTIVKPSVGLTPTQTGALAEELALAGLDFI
KDDELMADSPHSPFEERLDAVLRGLDRAAEQTGRRPLYAVNVSGEIDDMRRRADLVASRG
GNCIMVSVNAVGIAGLRDLRLHSSLPIHAHRNGWGALTRFPQLGYSYQVWQQLWRLAGAD
HLHVNGLRNKFWEPDDSVIASARAVLQPMNGGPAAMPVFSSAQSAEQAADTYAAIGTADL
MYVCGGGIMAHPDGVAAGVASIRQAWEAALEGTDLDEYAATHPELDAALRTFRGALSS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgaccgcatccgcgcccgctacctgatcgagacgccggtcggactcgagcgc
gccgccacctcgatggccggcgagcagtccacgggcaccttcatcgcactgcccggcgag
acccccgagctgcaccgccgtcatgcggcccacgtcgagtcgatcgagctccacgagacg
ggcgtcgacgcctcgctgtccgggtcgcggggccccgggccggtcgagcgcggcgaggtc
gtgctctccttcccgctcgagaacgtcggcacggcgctgccgaacctgctggcgaccgtg
gcgggcaacctcttcgagctgcagcagctgtccggcatccggctgatcgacctcgagctc
cccgcggagttcggggccgcgcacccgggctcgcagttcggcgtcgacggcacccgcgag
atcgccggggtgccgaccggaccgatcgtgggcacgatcgtgaagcccagcgtgggtctc
acccccacccagaccggggccctcgccgaggagctggcgctggccggactcgacttcatc
aaggacgacgagctgatggccgactcgccgcactcgcccttcgaggaacggctcgacgcg
gtgctgcgcggactcgaccgcgccgccgagcagaccggacggcggcctctctacgccgtc
aacgtcagcggcgagatcgacgacatgcggcggcgagcggacctcgtcgcgtcgcgcggc
gggaactgcatcatggtgagcgtgaacgcggtcggcatcgcggggctgcgcgacctgcgg
ctgcacagctccctcccgatccacgcccaccgcaacggatggggtgcgctcacccggttc
ccgcagctgggctactcgtatcaggtgtggcagcagctctggcgtctggccggcgccgac
cacctccacgtgaacgggctcaggaacaagttctgggagccggacgactcggtgatcgcc
tcggcgagggcggtgctccagccgatgaacggcgggccggccgcgatgccggtgttctcc
tccgctcagtcggcggagcaggccgccgacacctacgccgcgatcggcaccgccgacctg
atgtacgtctgcggaggcgggatcatggcccacccggacggtgtcgcggccggcgtggcg
agcatccgccaggcctgggaggccgccctcgagggcaccgatctggacgagtacgcggcg
acgcatccggagctcgatgccgcactgcggacgttccggggagcgctcagctcgtga

DBGET integrated database retrieval system