KEGG   Cnuibacter physcomitrellae: B5808_05115Help
Entry
B5808_05115       CDS       T04797                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cphy  Cnuibacter physcomitrellae
Pathway
cphy00020  Citrate cycle (TCA cycle)
cphy00480  Glutathione metabolism
cphy01100  Metabolic pathways
cphy01110  Biosynthesis of secondary metabolites
cphy01120  Microbial metabolism in diverse environments
cphy01130  Biosynthesis of antibiotics
cphy01200  Carbon metabolism
cphy01210  2-Oxocarboxylic acid metabolism
cphy01230  Biosynthesis of amino acids
Module
cphy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cphy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B5808_05115
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B5808_05115
Enzymes [BR:cphy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B5808_05115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP ART-PolyVal
Motif
Other DBs
NCBI-ProteinID: ARJ04675
UniProt: A0A1X9LHK6
LinkDB All DBs
Position
1093774..1094991
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQSIKDTLIHPYLDVNLEYYDLGIEKRDETDDQITIDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVIFREPIIISNIPRL
VPGWNKPIIVGRHAFGDQYRATDFRFEGEGTLTLTFTPKDGSEPQSFEVFESPGSGVAMG
MYNLDESIRDFARASLNYGLARNYPVYLSTKNTILKAYDGRFKDLFAEVFEDEFRAEFEA
RGLTYEHRLIDDMVASSLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLTTPDGS
IVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIFAWTRGLQHRGKLDGNQELIDFASTLED
VVIKTVESGKMTKDLALLVGPEQEYQTTEEFLATLAENLKTRIEG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgaagatcaaggttgagggcaccgtcgtcgagctcgacggcgacgagatgacgcga
atcatctggcagtccatcaaggacactctgatccacccgtacctcgacgtgaacctcgag
tactacgacctcggcatcgagaagcgcgacgagaccgacgaccagatcaccatcgacgcc
gcgaacgcgatcaagaagcacggcgtcggcgtcaagtgcgcgacgatcacgcccgacgag
gcgcgcgtcgaggagttcggtctcaagaagatgtggcgctcgccgaacggcaccatccgc
aacatcctgggcggcgtcatcttccgcgagccgatcatcatctccaacatcccgcgtctg
gtgccgggctggaacaagccgatcatcgtcggtcgtcacgcgttcggcgaccagtaccgc
gccaccgacttccgcttcgagggcgagggcacgctgaccctgacgttcacgccgaaggac
ggctccgagccccagtcgttcgaggtgttcgagtcgcccggcagcggtgtcgcgatgggc
atgtacaacctcgacgagtcgatccgcgacttcgcccgcgcgtcgctcaactacggcctc
gcccgcaactacccggtctacctgtcgacgaagaacaccatcctcaaggcctacgacggc
cggttcaaggacctcttcgccgaggtcttcgaggacgagttccgcgccgagttcgaggcc
cgcggcctgacctacgagcaccggctcatcgacgacatggtcgcgtcctcgctcaagtgg
gagggcggctacgtctgggcgtgcaagaactacgacggcgacgtccagagcgacaccgtg
gcgcaggggttcggctcgctcggtctcatgacctccgtgctcaccacccccgacggctcc
atcgtcgaggccgaggctgctcacggcaccgtcacccgccactaccgtcagcaccaggcg
ggcaagcccacgtcgaccaacccgatcgcctcgatcttcgcctggacccgcggtctgcag
caccgtggcaagctcgacggaaaccaggagctcatcgacttcgcgtcgaccctcgaggac
gtcgtcatcaagacggtcgagagcgggaagatgacgaaggacctcgccctcctcgttggc
cccgagcaggagtaccagaccaccgaggagttcctcgcgacgctggccgagaacctcaag
acccgcatcgagggctga

DBGET integrated database retrieval system