KEGG   Cnuibacter physcomitrellae: B5808_07880Help
Entry
B5808_07880       CDS       T04797                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cphy  Cnuibacter physcomitrellae
Brite
KEGG Orthology (KO) [BR:cphy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cphy01001]
    B5808_07880
Enzymes [BR:cphy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     B5808_07880
Protein kinases [BR:cphy01001]
 Serine/threonine kinases: Other
  Bacterial family
   B5808_07880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Haspin_kinase Kinase-like Kdo RIO1
Motif
Other DBs
NCBI-ProteinID: ARJ05135
UniProt: A0A1X9LIW5
LinkDB All DBs
Position
complement(1667101..1669035)
Genome map
AA seq 644 aa AA seqDB search
MTSATTDPMLGRLIDGRYQVKSRIARGGMATVYVATDLRLDRRVAIKVMHGHLADDEVFR
ERFVREARSAARLAHPNVVNVFDQGQDSDMAYLVMEYLPGMTLRDLLRERGRLGIEQAVD
VMDAVLGGLAAAHKAGIVHRDLKPENVLLADDGRIKIGDFGLARAASANTATGQALLGTI
AYLSPELLTRGVADTRSDVYAAGIMFSEMLVGAQPFTGDQPMQIAFKHANEPMPVPSSAN
PEVPEGLDDLILWATVKDPEERPADAKEMLDRLREVEAGLGIVRHAGTASQRTMLLPPEA
LGPSPDDRSTTVFTAPSVPAEEAAAEAAGPEATVQLVARKARRRRARGWWLLVAVLVVAA
GLGGTGWWYSAGPGSMTTIPTLAGSAPDSALAQLQEMGLKPDQRQQTSPTVAAGTVIDTD
PPGGTSIRSGSAVTVIVSSGPAMLAVPTLAGLAEADARAAITAAGFTAGTSTTQFSSDVA
SGVVIAATDPSGTALGSEYGEQQTIDLVVSLGAVPDVTGQTLDEAKAALGAVGLVATEGA
QDYNEDVPEGSVYQATVQTDPVRPGDSVVLDVSRGPAPVPVPNVEGLTRDEAKQALQAVG
LVPVYSVFWDAIPNALTKVQSVSPSVGTSVKKGTNVNLGITASG
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagcgcgaccaccgaccccatgctcggccgactcatcgacggccggtaccaggtg
aagtcgcgcatcgcccgcgggggcatggccaccgtctacgtcgccaccgacctccgcctg
gaccgccgggtcgcgatcaaggtgatgcacggccacctggccgatgacgaggtcttccgg
gagcgcttcgtccgtgaggcgcgctcggcggcgcgactggcgcatccgaacgtggtgaac
gtgttcgaccagggccaggactccgacatggcgtacctcgtcatggagtacctccccggc
atgacgctccgagacctgctccgcgagcggggacgcctcgggatcgagcaggccgtcgac
gtgatggatgcggtgctcggcggcctcgcagcagcgcacaaggccgggatcgtccaccgc
gacctcaagccggagaacgtgctgctcgccgacgacgggcgcatcaagatcggcgacttc
ggcctcgcgcgggccgcgagcgccaacacggccaccggccaggcgctcctcggcacgatc
gcctatctctcccccgagctcctcacccggggcgtcgccgacaccaggagcgacgtctac
gccgccggcatcatgttctcggagatgctcgtcggggcgcagccgttcacgggcgaccag
ccgatgcagatcgccttcaagcacgcgaacgagccgatgcccgtgcccagctcggcgaac
cccgaggtgcccgaggggctcgacgacctcatcctgtgggcgacggtcaaggatcccgag
gaacggcccgccgacgcgaaggagatgctcgaccggctgcgcgaggtggaggccgggctc
ggcatcgtccgccacgccggcacggcgtcgcagcgcacgatgctgctgcctcctgaagcg
ctcggcccctcgccggacgaccgctccaccacggtgttcaccgcgccctccgtgcccgcc
gaggaggcggccgccgaggccgccggtcccgaggccacggtccagctggtcgcccggaag
gcccgacggcgtcgtgcacgcgggtggtggctcctggtcgccgtcctcgtcgtcgccgcc
ggcctgggcggcacgggatggtggtactccgccgggcccggctcgatgaccacgatcccg
accctggccggatccgcacccgacagcgcactggcgcagctgcaggagatggggctgaag
cccgaccagcgtcagcagaccagcccgacggtcgccgccggcaccgtcatcgacaccgac
ccgcctggcggcacgagcatccgcagcggatcggcggtcacggtgatcgtctcgagcggg
cccgcgatgctggccgtgccgaccctcgccggtctcgccgaggccgacgcgcgcgccgcc
atcacggccgcggggttcaccgcgggcacgtcgaccacccagttctcctccgacgtcgcc
tccggggtcgtgatcgccgccaccgacccgtccggcacggccctcggatccgagtacggc
gagcagcagaccatcgacctggtcgtgtcgctcggagcggtgcccgatgtcaccggacag
acgctcgacgaggcgaaggccgcactcggggccgtcggcctcgtcgcgaccgagggcgcg
caggactacaacgaggacgtcccggagggatccgtctaccaggccaccgtgcagaccgac
ccggttcgccccggcgactccgtcgtcctcgacgtgtcgcgcgggccggcgcccgtgccc
gtccccaacgtcgagggcctgacccgcgacgaggcgaagcaggcgctgcaggcggtgggt
ctcgtgcccgtctactcggtgttctgggatgcgatccccaacgcgctgacgaaggtgcag
tcggtctcgccctcggtgggcacctcggtcaagaagggcacgaacgtcaacctcgggatc
accgcctccggctga

DBGET integrated database retrieval system