KEGG   Cnuibacter physcomitrellae: B5808_09640Help
Entry
B5808_09640       CDS       T04797                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cphy  Cnuibacter physcomitrellae
Pathway
cphy00500  Starch and sucrose metabolism
cphy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B5808_09640
Enzymes [BR:cphy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     B5808_09640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ARJ05455
UniProt: A0A1X9LJS4
LinkDB All DBs
Position
2039583..2042015
Genome map
AA seq 810 aa AA seqDB search
MHRRILSSALAVGIVAAGLGFVPIPSATAAPLVPLAPGAPGVAATWTSGDKHGLGTAVSD
ASKVWYTLGSGTTTEVFYPTVDRPQVQDLQFVVTDGVSRTYVERDDSVHETTLVDPEALE
YRQTDTAKDGSFRITKTYVTSPGRQTLLIDTRFEQLSGTTPLHLYVLFNPSTGGDGNANR
GNTLDGMLISQGGPTSAALASSLGFGDTTTGYSGTASDPYRQLTADHRLSTLYGGAATDG
NIVQSAEITVGRDTRFTLALGFGSTLNDAQGAASNALGDGFAATESAYVAGWRGYLSSLS
PAPSSVAGTSLETQYDVAVMTLRAHEDKTVRGAFVASLSVPWGQAVPGTMANPGYHAIWA
RDLYQVATALLAAGDRAGAARALDYMLNVQQRADGSMPHNTMVDGSDTGLTGIQLDEVAF
PAVLASMLGRSDSATWAKLKLSADYLVSHGPSTPQERWEEQAGFSPSTIAAEIAGLVASA
DIAVKNGDRASATRYLDTADLWRASLESWTVTHTGSIGTPHYERIDPIGTPDAGTTVCDT
NGAGCTDARDLVDGGFLELVRLGIRSADDPTIAASVAVVDAQLRVDTPSGAMWRRYNRDG
YGEHADGSPFNGTAGGIGRPWPVLAGERGQYELANGRDAMPYLRSMAATANDAYMIPEQV
WDTADTGRFTAGEATDSAAPLAWAMAQYVRLAQSISAGRNVDTPAVVAARYATGVEATFR
ANATTTWGESLFVVGSIPALGSWDTSKAIRLSSASYPDWAVEVALPAGVSLEYKYIRKSA
DGTVTWESGANRTITLPGSGTPVYRDTWRR
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgtcgcatcctctcctctgctctcgccgtcggcatcgtggccgccggcctcggg
ttcgtcccgatcccgtcggcgaccgccgcgccgttggtccccctcgcgcccggcgccccc
ggtgtcgccgccacctggaccagcggcgacaagcacggcctcggcaccgccgtctccgac
gcgtcgaaggtctggtacacgctgggatccgggaccaccaccgaggtgttctatcccacg
gtcgaccgtcctcaggtccaggacctccagttcgtcgtcaccgacggcgtctcgcgcacc
tacgtcgagcgcgacgactcggtgcacgagaccacgctggtcgaccccgaggctctcgag
taccgccagaccgacaccgcgaaggacgggtcgttccgcatcacgaagacgtacgtcacg
agccccggccggcagacgctcctcatcgacacgcgcttcgagcagctgagcggcacgact
ccgctgcacctctacgtgctcttcaacccgtcgaccgggggcgatggcaacgccaaccgc
ggcaacaccctggacgggatgctgatctcgcagggcggaccgacatcggccgcgctcgcc
tcctcgctcggcttcggcgacaccaccaccgggtacagcggcacggcgagcgatccgtac
cgccagctcaccgccgatcaccgtctgtcgacgctctacggcggggccgcgaccgacggg
aacatcgtgcagtccgccgagatcacggtcggtcgagacacccgcttcacgctcgccctc
ggattcgggtcgacgctcaacgatgcgcagggtgcggcgtccaatgccctgggcgacggc
ttcgcggcgaccgagtccgcctacgtggcgggatggcgcgggtacctctcgtccctctcc
cccgcaccgtcgagcgtggccggcacgagcctggagacccaatacgacgtcgccgtgatg
acgctccgggcgcacgaggacaagaccgttcgcggcgcgttcgtcgcctcgctctccgtc
ccctgggggcaggcagtgcccgggacgatggccaaccccgggtaccacgccatctgggcc
cgtgacctctatcaggtcgccaccgccctgctggccgcgggcgatcgtgccggtgccgcc
cgtgcgctcgactacatgctgaacgtgcagcagcgcgccgacggcagcatgccgcacaac
accatggtcgacggaagcgacaccgggctgaccggcatccagctcgacgaggtcgccttc
cccgctgtgctggcgtcgatgctcgggcgctccgacagcgccacctgggcgaagctcaag
ctctcggctgactacctcgtgtcccacgggccgtcgacgccccaggaacgctgggaggag
caggccggcttctccccctccaccatcgccgccgagatcgccgggctcgtcgcgtccgcc
gacatcgccgtcaagaacggcgaccgggcgtcggcgacccgctacctcgacaccgccgac
ctctggcgcgccagcctcgagtcgtggaccgtgacgcacaccgggtcgatcggaaccccg
cattacgagcgcatcgaccccataggcaccccggatgcgggcacgaccgtctgcgacacg
aacggcgccggatgcacagacgctcgcgacctcgtcgacggcggattcctcgagctcgtg
cggttgggcatccgctcggccgacgacccgaccatcgccgcctcggtcgcggtcgtcgac
gcccagcttcgtgtcgacacgccttcgggcgcgatgtggcggcggtacaaccgtgacggg
tacggcgagcatgccgacggatcccccttcaacggcacggcgggcgggatcggccggccg
tggcccgtcctcgcgggcgagcgggggcagtacgagctcgcgaacggccgcgacgcgatg
ccctaccttcgctcgatggcggcgacggcgaacgacgcgtacatgatccccgagcaggtg
tgggacaccgccgacacgggccgcttcaccgcgggcgaggccaccgactcggccgctccc
ctggcctgggcgatggcgcagtacgtcagactcgcgcagtccatcagcgccggccgcaac
gtcgacacgcccgctgtcgtcgcagcccgctacgcgacgggtgtcgaggccaccttccgc
gcgaacgccacgacgacctggggtgagagcctcttcgtcgtggggagcatccccgcgctg
ggctcctgggacacgtcgaaggcgatccggctctcgagcgcgtcgtatccggactgggcc
gtcgaggtggccctgcccgcgggtgtctccctcgagtacaagtacatccggaagtcggcc
gacggcaccgtgacgtgggagtccggcgccaaccggaccatcaccctgccgggctccggc
acccccgtctaccgagacacctggcgccgctga

DBGET integrated database retrieval system