KEGG   Cnuibacter physcomitrellae: B5808_17095Help
Entry
B5808_17095       CDS       T04797                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
cphy  Cnuibacter physcomitrellae
Pathway
cphy00250  Alanine, aspartate and glutamate metabolism
cphy00280  Valine, leucine and isoleucine degradation
cphy00310  Lysine degradation
cphy00410  beta-Alanine metabolism
cphy00640  Propanoate metabolism
cphy00650  Butanoate metabolism
cphy01100  Metabolic pathways
cphy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B5808_17095
   00650 Butanoate metabolism
    B5808_17095
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B5808_17095
   00280 Valine, leucine and isoleucine degradation
    B5808_17095
   00310 Lysine degradation
    B5808_17095
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B5808_17095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cphy01007]
    B5808_17095
Enzymes [BR:cphy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B5808_17095
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     B5808_17095
    2.6.1.48  5-aminovalerate transaminase
     B5808_17095
Amino acid related enzymes [BR:cphy01007]
 Aminotransferase (transaminase)
  Class III
   B5808_17095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ARJ06748
UniProt: A0A1X9LQZ9
LinkDB All DBs
Position
3672725..3674119
Genome map
AA seq 464 aa AA seqDB search
MTFAPVLDQGPGTIPAGSAPVGGPDLPQERRLVTEIPGPLSREMLARKAAAVPNGVGVTL
PIAVVAAGGGVVVDVDGNSLIDLGSGIAVTGVGNAAPEVVAAVTEQVARFTHTCFTITAY
DGYIRVAEALNRLTPGDHEKRTALFNSGAEAVENAVKIARAYTRKQAVVVFDHAYHGRTN
LTMAMTAKSMPYKSGFGPFASEVYRVPLSYPFRDGGLSGAEAAAAAISQIEKQVGASNLA
AVVIEPIQGEGGFIEPALGFLPALAAWAKDNGVVFVADEIQTGFSRTGHLFASEHEGLVP
DLITTAKGIAGGLPLSAVTGRAEIMDAAHAGGLGGTYGGNPVACAAALASIDLFENGGLT
ERAREIDVVLRGALDALRAVDDRVGDVRGRGAMMAIELVDPATGAPDAALTARIAAFAHA
NGVVLLTCGTYGNVIRFLPPLTISDDLLREGVRVVGEALAANPL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgcacccgttctcgaccagggccccggcaccatccccgccggcagcgccccc
gtcggcggcccggacctcccccaggagcgccggctcgtcaccgagatccccggaccgctc
tcccgcgagatgctcgcccgcaaggcggccgccgtgccgaacggcgtcggcgtgaccctc
cccatcgccgtcgtcgcggccggcggcggggtcgtcgtcgacgtcgacggcaactccctc
atcgacctgggctcgggcatcgccgtcaccggagtgggcaacgccgcccccgaggtggtc
gccgccgtcaccgagcaggtcgcccgcttcacgcacacctgcttcaccatcaccgcctac
gacgggtacatccgcgtcgccgaggcgctcaaccggctcaccccgggcgaccacgagaag
cgcaccgcgctgttcaactccggcgccgaggccgtcgagaacgcggtgaagatcgcccgt
gcctacacccgcaagcaggccgtggtcgtgttcgatcacgcctaccacggccgcaccaac
ctcacgatggcgatgaccgcgaagtcgatgccctacaagagcggattcgggccgttcgcc
tccgaggtctaccgtgtcccgctctcctaccccttccgcgacggcggcctctccggagcg
gaggcggcggcggcggcgatctcgcagatcgagaagcaggtcggcgcgagcaacctcgcg
gccgtcgtgatcgagcccatccagggcgagggcggcttcatcgagcccgcgctcggattc
ctgcccgccctggccgcctgggcgaaggacaacggcgtggtgttcgtcgccgacgagatc
cagaccgggttcagccgcaccgggcacctcttcgccagcgagcacgagggcctcgtcccc
gacctcatcaccaccgccaagggcatcgccggagggctcccgctgtcggcggtgaccggg
cgcgccgagatcatggatgccgcccacgccggtgggctgggcggcacctacggcggcaac
cccgtcgcctgcgctgcggcgctggcctcgatcgacctgttcgagaacggcgggctcacg
gagcgcgcccgcgagatcgacgtggtgctccgcggtgcgctcgacgcgctccgcgcggtc
gacgaccgcgtcggcgacgtgcgcggacgcggcgcgatgatggcgatcgagctcgtcgat
cccgccacgggcgccccggatgcggcgctcaccgcgaggatcgccgccttcgcccacgcg
aacggcgtcgtgctcctcacctgcggcacgtacggcaacgtcatccgcttcctcccgccg
ctgaccatctccgacgacctcctccgcgagggcgtgcgcgtggtgggcgaggccctggcg
gcgaacccgctatga

DBGET integrated database retrieval system