KEGG   Cnuibacter physcomitrellae: B5808_20050Help
Entry
B5808_20050       CDS       T04797                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
cphy  Cnuibacter physcomitrellae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase PNKP_ligase
Motif
Other DBs
NCBI-ProteinID: ARJ07671
UniProt: A0A1X9LUI1
LinkDB All DBs
Position
unnamed1:175956..176957
Genome map
AA seq 333 aa AA seqDB search
MSDLPAGLRPPEVALARLADTIPGPGALPGGSLYEPKWDGFRLVIVRAADVTLWSRQGKD
LTRHFPDLAAAAEEQLPHGYVVDGEAVVWSEDRLDFDALQKRLTTSPAAVQRLAHQRPAS
YAAFDLLAVDDHDARSLPLRDRRALLEQLAQDWAPPLNLSPATTDYGEAVAWFEQLHTAG
IEGLVIKGAGDRYSGGVRQWVKVKHRDTLDVICAAVIGTLRQPQELVVGLPVDGELRIVG
RSTPLRAAPARGLGRLLRPAVGEGHPWPAQIKPGALDRFGNSGRELVDLTLVEPIVVEIS
ADVAWSGRSFRHAVRYLRARPELDLADVPERER
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccttccggcagggctgcgcccgcctgaggttgctctggcccgcctggccgac
acgatcccggggccgggcgctctgccgggtgggagcctgtacgagcccaaatgggacggg
ttccgcctcgtcatcgtccgcgccgccgacgtgacgctgtggtcgcgtcagggcaaggac
ctcactcggcacttcccggacctcgcggcggccgcggaggagcagctgccccacgggtac
gtcgtcgacggcgaagctgtcgtgtggtccgaggacaggctggacttcgacgcgctgcag
aagcggctcaccaccagccctgccgcggtgcagcgcctcgcccaccagcggccggcgtcc
tatgccgcgttcgaccttctcgccgtcgacgaccatgacgcacgctcgctaccgctccgc
gaccgccgagccctgctcgagcagctcgcccaagactgggccccgcccctgaatctctcg
cccgccaccaccgactacggcgaggcggtggcctggttcgagcagctgcacacggcaggg
atcgagggactcgtcatcaagggcgccggagaccggtacagcgggggagtgcggcagtgg
gtgaaggtcaagcaccgcgacaccctcgacgtgatctgcgccgccgtcatcggcactctc
cgccagccccaggagctcgtcgtcggcctgcccgtcgatggagagctgcggatcgtgggc
cgcagcacgccgctgcgcgcggcgccggcccgtggcctcggccgcttgctacggccagcg
gtgggggaggggcatccctggccggcacagatcaagcccggcgccctggaccgattcggc
aacagcggccgcgagctcgtcgacctcactctcgtcgagccgatcgtggtcgagatctcc
gccgacgtcgcctggtccggacgatccttccggcacgccgtccgctacctgcgagctcga
cccgagctcgacttggctgacgttcccgagcgggagcgctga

DBGET integrated database retrieval system