KEGG   Chitinophaga pinensis: Cpin_0233Help
Entry
Cpin_0233         CDS       T00959                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00473  D-Alanine metabolism
cpi01100  Metabolic pathways
cpi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cpi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Cpin_0233
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Cpin_0233
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cpi01011]
    Cpin_0233
Enzymes [BR:cpi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Cpin_0233
Peptidoglycan biosynthesis and degradation proteins [BR:cpi01011]
 Precursor biosynthesis
  Racemase
   Cpin_0233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ACU57733
UniProt: C7PDB0
LinkDB All DBs
Position
279777..282281
Genome map
AA seq 834 aa AA seqDB search
MYNAESISKVLKGELLQQTGNPEIEHILLDSRKLSFPETSLFIPLVSSRRNAHQYIQELY
EKGVSNFIVSEPVPEGKYPKANIILVKDTMQALHALVAYHRQQFHIPVIGITGSNGKTIV
KEWLYQLLEKDYNIVRSPKSYNSQIGVPLSVWQMKPEHQLAIFEAGISQPGEMEHLEKII
RPNIGIFTNIGEAHNEGFLNIRQKINEKLVLFSKSDLLIYSKDYLALNECVLNFHNLVGK
KDNHEGGLQLFTWSRKTEADLRIISVDKSEHHSRIDALYQTIPIHINIPFVDEGSVENAI
HCWALMLHLGMEHSVIQQRMDQLGNIAMRLELKQGINNCSVINDSYNSDLGSLAIALEFL
QQQQQHPTRTVILSDILQSGKSDASLYEEVASLLQQKGINKVIGIGKNIFREKKSFQQIT
GLKSSFFLTTEEFIQQFNQQDFQHETILLKGARIFEFERIGKLLEQKVHQTILEINLSAV
THNVKQYQSLLKPGTKLMAMVKAFSYGSGSFEIANLLQFHGVDYLAVAYADEGVDLRRTG
ITMPIMVMNPEPSSFDAILQWNLEPEIYSLHLLKQFEEEVQLAGKTGFPVHIKLDTGMHR
LGFEKKDIPELARLLSDNIYLKVNSVFSHLAASEDPAMDAFTKQQGQLFFEMSHELQKAL
GYTVIRHIANSAAIERHPDLQLDMVRLGIGMYGIDSANKIQDQLRPASTLKTTVAQVKHL
STGDTVGYGAKWVAKGPSVTATVRIGYADGYPRRLSNGKGKMLVRGQLAPVAGVVAMDML
MLDVTNIPEVAEGDEVIVFGNELPVQQVSAWADTIPYEILTGISQRVKRVYFEE
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
gtgtataacgcagaaagtatcagcaaagtgctgaaaggtgaactattgcagcagacgggt
aatccggagattgaacacattttgctggacagccggaaactcagctttcctgaaacatct
ctttttataccactggtaagcagccgtcgtaatgcacaccagtatatacaggagctgtac
gaaaaaggtgtttccaatttcattgtaagtgaacctgtgccagaggggaaatatccgaaa
gccaacatcatattagtaaaagacacaatgcaggcactgcacgcgctggtagcttatcac
cggcagcagttccatatacctgtgatcggtattaccggcagtaacggtaaaaccatcgtc
aaagaatggctgtatcagctattggagaaagattataatatcgtccgcagtcctaaaagc
tataattctcagatcggcgttccactctctgtatggcagatgaaaccggagcaccagctg
gctatttttgaagcaggcatttcccaaccaggggaaatggagcatcttgaaaagattatc
cgcccgaacatcggcatttttaccaatatcggagaagcgcataatgagggcttcctgaac
atccgtcagaagatcaatgaaaagctggttttgttttccaaaagcgacctgctgatctat
tccaaggactatctcgcactgaacgaatgtgtattgaattttcacaacctggtaggcaag
aaagataaccatgaaggtggtttacagctgtttacctggtcccgtaaaacggaagcagat
cttcgcattatcagcgttgataaaagtgagcatcattcccgtattgacgcattatatcag
accattcccatccacatcaatattccctttgtagatgaaggttcagtggagaatgccata
cattgctgggcgctgatgctgcacctgggtatggaacattctgtaatacaacaacggatg
gaccagctgggcaatatagccatgcgcctggaactgaaacaggggatcaacaactgctct
gtcatcaatgacagttataattccgatcttggctcactggccattgcactggaattcctg
caacaacaacagcagcatcctactcgtacggtcatcctcagtgacatcctgcagagtggc
aaaagcgatgcgtctttgtacgaggaagtggctagtctgctccagcagaaaggcatcaat
aaagtgatcggtatcgggaaaaatattttcagagagaaaaaaagctttcaacagatcact
ggtctgaaaagcagttttttcctgacgacagaagaatttattcagcaattcaatcagcag
gattttcagcatgaaaccatcctcctgaaaggcgcgcgtatatttgaatttgagcggatt
ggtaagctgttggaacagaaggtacaccagacaatcctggagatcaatctgagtgctgta
acgcacaacgtaaagcaatatcagtcgttgctgaagccgggtaccaaactgatggccatg
gtgaaagcattctcttatggcagcggaagttttgaaattgcaaacctattgcagttccat
ggtgtagattacctcgccgttgcttatgctgatgaaggtgtggatctgaggcgaacaggc
attacgatgccgattatggtcatgaatcctgaacccagttcttttgacgctatcctccaa
tggaatctggaacccgaaatatactccctccacctgttaaaacagtttgaagaagaagta
cagctggccggtaaaaccggtttccctgtacacattaaactggatacaggtatgcacagg
ctgggttttgagaagaaagacatccccgagctggcccgtttactgagtgataatatctat
ctgaaagtaaattctgtgttcagtcacctggccgccagtgaagatccggcaatggacgcc
ttcaccaaacagcagggacagttattcttcgaaatgagccacgaactgcaaaaggcattg
ggctatacagtgatcaggcatattgcaaacagcgcagctatcgagcgtcatcctgacctc
cagctggatatggtcagactgggtatcggcatgtatggcatagacagcgccaacaagata
caggaccagttacgtccggccagtacgctgaaaacaacggttgcacaggtaaaacacctg
tccaccggcgatacagtaggttacggggccaaatgggtggcgaaagggccatctgtgacg
gcaacagtacgcatcgggtatgctgacggctatccccgccgcctgagcaacggaaaggga
aagatgctcgtacgcgggcaactggcccctgtggcaggtgttgtggcgatggatatgctg
atgctggatgtaaccaatattccggaagtggcagaaggagacgaagtgatcgtatttggc
aatgagctgccggtacagcaggtatctgcctgggcagacaccattccttatgaaatatta
acaggaatttcgcagcgggtaaagcgggtatatttcgaggagtga

DBGET integrated database retrieval system